BLASTX nr result
ID: Coptis24_contig00031755
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00031755 (333 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533114.1| pentatricopeptide repeat-containing protein,... 70 2e-10 ref|XP_002525630.1| pentatricopeptide repeat-containing protein,... 69 4e-10 ref|XP_003538644.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 ref|XP_004141574.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 ref|NP_180537.1| pentatricopeptide repeat-containing protein [Ar... 67 2e-09 >ref|XP_002533114.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527077|gb|EEF29259.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 480 Score = 69.7 bits (169), Expect = 2e-10 Identities = 36/97 (37%), Positives = 55/97 (56%) Frame = +2 Query: 41 RPTTHDDISSALQSCTSLKQAKQIHVCILRNNPQDAEHLYAKLLLVSTSLPSMSATALDY 220 R T SS Q+CT+L+ KQIH ++ + + +L+ S + +DY Sbjct: 9 RSTKRQQPSSLWQNCTNLRSLKQIHASLIIKGFNSSSYALRELIFASAIV---IPGTIDY 65 Query: 221 ALLVFEQLEEPNIFMWNTMIRGYAGSESPKRTISFYT 331 A +F+Q+ EP+IFMWNTM+RG + S SP + +S YT Sbjct: 66 AHQLFDQVAEPDIFMWNTMMRGSSQSPSPIKAVSLYT 102 >ref|XP_002525630.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535066|gb|EEF36748.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 765 Score = 68.9 bits (167), Expect = 4e-10 Identities = 40/117 (34%), Positives = 61/117 (52%), Gaps = 17/117 (14%) Frame = +2 Query: 29 SSPLRP-------------TTHDDISSALQSCTSLKQAKQIHVCILRN----NPQDAEHL 157 S PLRP T+H S + CT+LK K++H ILR+ +P +A L Sbjct: 10 SIPLRPNHSILTVPNGRPVTSHSQTLSLIDQCTNLKHLKELHATILRSGLFFHPYNASKL 69 Query: 158 YAKLLLVSTSLPSMSATALDYALLVFEQLEEPNIFMWNTMIRGYAGSESPKRTISFY 328 ++ L S S +LDYA VFE++ +PN++ WNT+IR +A S P ++ + Sbjct: 70 FSVAALSSFS-------SLDYARKVFEEISQPNLYTWNTLIRAFASSPEPIHSLLIF 119 >ref|XP_003538644.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14820-like [Glycine max] Length = 721 Score = 67.0 bits (162), Expect = 2e-09 Identities = 37/105 (35%), Positives = 60/105 (57%) Frame = +2 Query: 14 VALSFSSPLRPTTHDDISSALQSCTSLKQAKQIHVCILRNNPQDAEHLYAKLLLVSTSLP 193 +A++ S+ L P+ + L SC +L+ KQIH ILR+ ++ L KL+L +LP Sbjct: 1 MAMAMSTRLIPSPSE--KGLLASCKTLRHVKQIHAQILRSKMDNSNLLLLKLVLCCCTLP 58 Query: 194 SMSATALDYALLVFEQLEEPNIFMWNTMIRGYAGSESPKRTISFY 328 S S +ALDYAL +F + P N ++R ++ +P+ T+S Y Sbjct: 59 SPSPSALDYALSLFSHIPNPPTRFSNQLLRQFSRGPTPENTLSLY 103 >ref|XP_004141574.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Cucumis sativus] Length = 542 Score = 66.6 bits (161), Expect = 2e-09 Identities = 34/89 (38%), Positives = 51/89 (57%) Frame = +2 Query: 65 SSALQSCTSLKQAKQIHVCILRNNPQDAEHLYAKLLLVSTSLPSMSATALDYALLVFEQL 244 SS Q CT+ + KQ+H ++ N + +L+ VS + S + +DYA +F Q+ Sbjct: 17 SSLWQKCTNFRSLKQLHAFLIVNGLNSTTSVLRELIFVSAIVVSGT---MDYAHQLFAQI 73 Query: 245 EEPNIFMWNTMIRGYAGSESPKRTISFYT 331 +P+IFMWNTMIRG A + P +S YT Sbjct: 74 SQPDIFMWNTMIRGSAQTLKPATAVSLYT 102 >ref|NP_180537.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75100656|sp|O82380.1|PP175_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g29760, chloroplastic; Flags: Precursor gi|3582328|gb|AAC35225.1| hypothetical protein [Arabidopsis thaliana] gi|330253207|gb|AEC08301.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 738 Score = 66.6 bits (161), Expect = 2e-09 Identities = 39/106 (36%), Positives = 62/106 (58%), Gaps = 7/106 (6%) Frame = +2 Query: 23 SFSSPLRPTTHDDIS---SALQSCTSLKQAKQIHVCILR----NNPQDAEHLYAKLLLVS 181 +FS+P +PTT+++ S S ++ C SL+Q KQ H ++R ++P A L+A L S Sbjct: 17 NFSNPNQPTTNNERSRHISLIERCVSLRQLKQTHGHMIRTGTFSDPYSASKLFAMAALSS 76 Query: 182 TSLPSMSATALDYALLVFEQLEEPNIFMWNTMIRGYAGSESPKRTI 319 + +L+YA VF+++ +PN F WNT+IR YA P +I Sbjct: 77 FA-------SLEYARKVFDEIPKPNSFAWNTLIRAYASGPDPVLSI 115