BLASTX nr result
ID: Coptis24_contig00031682
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00031682 (633 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514699.1| ATP binding protein, putative [Ricinus commu... 88 2e-15 ref|XP_002281382.2| PREDICTED: zinc finger Ran-binding domain-co... 85 1e-14 emb|CBI15155.3| unnamed protein product [Vitis vinifera] 85 1e-14 emb|CAN78815.1| hypothetical protein VITISV_041732 [Vitis vinifera] 85 1e-14 ref|XP_003528212.1| PREDICTED: zinc finger Ran-binding domain-co... 74 2e-11 >ref|XP_002514699.1| ATP binding protein, putative [Ricinus communis] gi|223546303|gb|EEF47805.1| ATP binding protein, putative [Ricinus communis] Length = 1229 Score = 87.8 bits (216), Expect = 2e-15 Identities = 41/64 (64%), Positives = 49/64 (76%) Frame = +1 Query: 442 FTISSEICSPDSFMITPLPLPGFPYTGEFDCLQKLSSWLSFVDPSHYTQNHGGEKASVYK 621 F + EICSPDSF +TP L GF Y GE +CL++L+ +L+ V PSHYTQNHGG KA VYK Sbjct: 82 FRVRLEICSPDSFSLTPEALRGFIYAGEEECLRRLNVFLADVMPSHYTQNHGGGKACVYK 141 Query: 622 LRDY 633 LRDY Sbjct: 142 LRDY 145 >ref|XP_002281382.2| PREDICTED: zinc finger Ran-binding domain-containing protein 3-like [Vitis vinifera] Length = 1280 Score = 84.7 bits (208), Expect = 1e-14 Identities = 40/64 (62%), Positives = 46/64 (71%) Frame = +1 Query: 442 FTISSEICSPDSFMITPLPLPGFPYTGEFDCLQKLSSWLSFVDPSHYTQNHGGEKASVYK 621 F + EICSPDSF ITP + GF Y GE +CLQ+L+ L+ V PSHYTQNH G KA VYK Sbjct: 76 FRVRLEICSPDSFSITPKAVHGFAYPGEAECLQRLNDCLANVVPSHYTQNHSGGKACVYK 135 Query: 622 LRDY 633 L DY Sbjct: 136 LGDY 139 >emb|CBI15155.3| unnamed protein product [Vitis vinifera] Length = 1201 Score = 84.7 bits (208), Expect = 1e-14 Identities = 40/64 (62%), Positives = 46/64 (71%) Frame = +1 Query: 442 FTISSEICSPDSFMITPLPLPGFPYTGEFDCLQKLSSWLSFVDPSHYTQNHGGEKASVYK 621 F + EICSPDSF ITP + GF Y GE +CLQ+L+ L+ V PSHYTQNH G KA VYK Sbjct: 76 FRVRLEICSPDSFSITPKAVHGFAYPGEAECLQRLNDCLANVVPSHYTQNHSGGKACVYK 135 Query: 622 LRDY 633 L DY Sbjct: 136 LGDY 139 >emb|CAN78815.1| hypothetical protein VITISV_041732 [Vitis vinifera] Length = 781 Score = 84.7 bits (208), Expect = 1e-14 Identities = 40/64 (62%), Positives = 46/64 (71%) Frame = +1 Query: 442 FTISSEICSPDSFMITPLPLPGFPYTGEFDCLQKLSSWLSFVDPSHYTQNHGGEKASVYK 621 F + EICSPDSF ITP + GF Y GE +CLQ+L+ L+ V PSHYTQNH G KA VYK Sbjct: 76 FRVRLEICSPDSFSITPKAVHGFAYPGEAECLQRLNDCLANVVPSHYTQNHSGGKACVYK 135 Query: 622 LRDY 633 L DY Sbjct: 136 LGDY 139 >ref|XP_003528212.1| PREDICTED: zinc finger Ran-binding domain-containing protein 3-like [Glycine max] Length = 1193 Score = 74.3 bits (181), Expect = 2e-11 Identities = 39/66 (59%), Positives = 42/66 (63%), Gaps = 2/66 (3%) Frame = +1 Query: 442 FTISSEICSPDSFMITPLPLPGFPYTGEFDCLQKLSSWLS--FVDPSHYTQNHGGEKASV 615 F EICSPDSF ITPLPL FP+ G CL LSS LS V PSHYTQ GEK V Sbjct: 71 FLARLEICSPDSFSITPLPLSSFPFPGHQHCLNTLSSTLSQQHVVPSHYTQTSEGEKVCV 130 Query: 616 YKLRDY 633 +KL +Y Sbjct: 131 FKLAEY 136