BLASTX nr result
ID: Coptis24_contig00031627
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00031627 (255 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283452.1| PREDICTED: 39S ribosomal protein L47, mitoch... 62 5e-08 ref|XP_002320251.1| predicted protein [Populus trichocarpa] gi|1... 60 2e-07 ref|XP_002889667.1| ribosomal protein L29 family protein [Arabid... 59 3e-07 ref|NP_172261.1| ribosomal protein L29 family protein [Arabidops... 59 3e-07 ref|XP_002511442.1| structural constituent of ribosome, putative... 58 7e-07 >ref|XP_002283452.1| PREDICTED: 39S ribosomal protein L47, mitochondrial isoform 1 [Vitis vinifera] gi|225457112|ref|XP_002283459.1| PREDICTED: 39S ribosomal protein L47, mitochondrial isoform 2 [Vitis vinifera] gi|297733826|emb|CBI15073.3| unnamed protein product [Vitis vinifera] Length = 140 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +2 Query: 161 YNPLEAFFEADRSQEEEKPVVYGRGWKASEL 253 YNPLE FFEADRS +E+KPVVYGRGWKASEL Sbjct: 31 YNPLEEFFEADRSPDEDKPVVYGRGWKASEL 61 >ref|XP_002320251.1| predicted protein [Populus trichocarpa] gi|118483659|gb|ABK93723.1| unknown [Populus trichocarpa] gi|222861024|gb|EEE98566.1| predicted protein [Populus trichocarpa] Length = 142 Score = 59.7 bits (143), Expect = 2e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +2 Query: 161 YNPLEAFFEADRSQEEEKPVVYGRGWKASEL 253 +NPLE FFEADRSQ+E+KP+VYGR WKASEL Sbjct: 33 HNPLEEFFEADRSQDEDKPIVYGRSWKASEL 63 >ref|XP_002889667.1| ribosomal protein L29 family protein [Arabidopsis lyrata subsp. lyrata] gi|297335509|gb|EFH65926.1| ribosomal protein L29 family protein [Arabidopsis lyrata subsp. lyrata] Length = 143 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 164 NPLEAFFEADRSQEEEKPVVYGRGWKASEL 253 NPLE FFE DRSQ+E+KPVVYGRGWKASEL Sbjct: 35 NPLEEFFEFDRSQDEDKPVVYGRGWKASEL 64 >ref|NP_172261.1| ribosomal protein L29 family protein [Arabidopsis thaliana] gi|14030695|gb|AAK53022.1|AF375438_1 At1g07830/F24B9_7 [Arabidopsis thaliana] gi|19548071|gb|AAL87399.1| At1g07830/F24B9_7 [Arabidopsis thaliana] gi|332190068|gb|AEE28189.1| ribosomal protein L29 family protein [Arabidopsis thaliana] Length = 144 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 164 NPLEAFFEADRSQEEEKPVVYGRGWKASEL 253 NPLE FFE DRSQ+E+KPVVYGRGWKASEL Sbjct: 36 NPLEEFFEFDRSQDEDKPVVYGRGWKASEL 65 >ref|XP_002511442.1| structural constituent of ribosome, putative [Ricinus communis] gi|223550557|gb|EEF52044.1| structural constituent of ribosome, putative [Ricinus communis] Length = 163 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +2 Query: 164 NPLEAFFEADRSQEEEKPVVYGRGWKASEL 253 NPLE FFEADRSQ+E KPVVYGR WKASEL Sbjct: 35 NPLEEFFEADRSQDEAKPVVYGRSWKASEL 64