BLASTX nr result
ID: Coptis24_contig00031625
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00031625 (239 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279903.2| PREDICTED: helicase SKI2W-like [Vitis vinifera] 110 9e-23 emb|CBI16013.3| unnamed protein product [Vitis vinifera] 110 9e-23 ref|XP_003552970.1| PREDICTED: helicase SKI2W-like [Glycine max] 103 1e-20 ref|XP_004163748.1| PREDICTED: helicase SKI2W-like [Cucumis sati... 100 9e-20 ref|XP_004145322.1| PREDICTED: helicase SKI2W-like [Cucumis sati... 100 9e-20 >ref|XP_002279903.2| PREDICTED: helicase SKI2W-like [Vitis vinifera] Length = 1379 Score = 110 bits (276), Expect = 9e-23 Identities = 54/70 (77%), Positives = 60/70 (85%) Frame = +2 Query: 29 GSNEISVPGGPQKKEAWAIASGSESIADRFCELVPDMALEFPFELDTFQKEAIYYLEKGE 208 G + S GG QKKEAWA++ G+E IAD F ELVPDMAL+FPFELDTFQKEAIYYLEKG+ Sbjct: 337 GLDGTSDDGGRQKKEAWAVSGGNEGIADHFHELVPDMALDFPFELDTFQKEAIYYLEKGD 396 Query: 209 SVFVAAHTSA 238 SVFVAAHTSA Sbjct: 397 SVFVAAHTSA 406 >emb|CBI16013.3| unnamed protein product [Vitis vinifera] Length = 1082 Score = 110 bits (276), Expect = 9e-23 Identities = 54/70 (77%), Positives = 60/70 (85%) Frame = +2 Query: 29 GSNEISVPGGPQKKEAWAIASGSESIADRFCELVPDMALEFPFELDTFQKEAIYYLEKGE 208 G + S GG QKKEAWA++ G+E IAD F ELVPDMAL+FPFELDTFQKEAIYYLEKG+ Sbjct: 99 GLDGTSDDGGRQKKEAWAVSGGNEGIADHFHELVPDMALDFPFELDTFQKEAIYYLEKGD 158 Query: 209 SVFVAAHTSA 238 SVFVAAHTSA Sbjct: 159 SVFVAAHTSA 168 >ref|XP_003552970.1| PREDICTED: helicase SKI2W-like [Glycine max] Length = 1342 Score = 103 bits (258), Expect = 1e-20 Identities = 52/61 (85%), Positives = 52/61 (85%) Frame = +2 Query: 56 GPQKKEAWAIASGSESIADRFCELVPDMALEFPFELDTFQKEAIYYLEKGESVFVAAHTS 235 G QKKEAWAI SE I D F ELVPDMALEFPFELD FQKEAIYYLEKGESVFVAAHTS Sbjct: 318 GQQKKEAWAIHETSEQIVDSFHELVPDMALEFPFELDAFQKEAIYYLEKGESVFVAAHTS 377 Query: 236 A 238 A Sbjct: 378 A 378 >ref|XP_004163748.1| PREDICTED: helicase SKI2W-like [Cucumis sativus] Length = 684 Score = 100 bits (250), Expect = 9e-20 Identities = 51/79 (64%), Positives = 62/79 (78%) Frame = +2 Query: 2 STDTGRLILGSNEISVPGGPQKKEAWAIASGSESIADRFCELVPDMALEFPFELDTFQKE 181 S ++G L S++ + G QKKEAW + G E I+ RF +LVPDMAL+FPFELDTFQKE Sbjct: 310 SLESGGFSLSSDQATEVGA-QKKEAWVVVGGREDISLRFHDLVPDMALDFPFELDTFQKE 368 Query: 182 AIYYLEKGESVFVAAHTSA 238 AIY+LEKG+SVFVAAHTSA Sbjct: 369 AIYHLEKGDSVFVAAHTSA 387 >ref|XP_004145322.1| PREDICTED: helicase SKI2W-like [Cucumis sativus] Length = 1352 Score = 100 bits (250), Expect = 9e-20 Identities = 51/79 (64%), Positives = 62/79 (78%) Frame = +2 Query: 2 STDTGRLILGSNEISVPGGPQKKEAWAIASGSESIADRFCELVPDMALEFPFELDTFQKE 181 S ++G L S++ + G QKKEAW + G E I+ RF +LVPDMAL+FPFELDTFQKE Sbjct: 310 SLESGGFSLSSDQATEVGA-QKKEAWVVVGGREDISLRFHDLVPDMALDFPFELDTFQKE 368 Query: 182 AIYYLEKGESVFVAAHTSA 238 AIY+LEKG+SVFVAAHTSA Sbjct: 369 AIYHLEKGDSVFVAAHTSA 387