BLASTX nr result
ID: Coptis24_contig00031598
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00031598 (315 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002892331.1| pentatricopeptide repeat-containing protein ... 78 8e-13 ref|XP_003540386.1| PREDICTED: pentatricopeptide repeat-containi... 75 7e-12 ref|NP_563765.1| pentatricopeptide repeat-containing protein [Ar... 74 1e-11 ref|XP_002525148.1| pentatricopeptide repeat-containing protein,... 72 6e-11 ref|XP_002278909.1| PREDICTED: pentatricopeptide repeat-containi... 70 1e-10 >ref|XP_002892331.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297338173|gb|EFH68590.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 343 Score = 77.8 bits (190), Expect = 8e-13 Identities = 33/59 (55%), Positives = 51/59 (86%) Frame = +2 Query: 2 EGCLEKKEFVLGGKMVIQMVEKGFIPYIRVRQRVLDGLASVGKRQSACLVRQKLADVRS 178 EGCLE +E++L GKMV++M ++GFIPYI+VRQ+V++ L S+G+ + AC VRQ+L+++RS Sbjct: 285 EGCLEVREYILAGKMVMRMTDRGFIPYIKVRQKVVERLISIGEWKLACTVRQRLSELRS 343 >ref|XP_003540386.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06270-like [Glycine max] Length = 342 Score = 74.7 bits (182), Expect = 7e-12 Identities = 33/59 (55%), Positives = 46/59 (77%) Frame = +2 Query: 2 EGCLEKKEFVLGGKMVIQMVEKGFIPYIRVRQRVLDGLASVGKRQSACLVRQKLADVRS 178 EGCLEK+E+VL K+ M E+GFIPYIRVRQ++++GLAS+ + AC VRQ+ A ++S Sbjct: 284 EGCLEKREYVLAAKVATGMTERGFIPYIRVRQKIIEGLASIDEWNLACAVRQRFAALKS 342 >ref|NP_563765.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75264068|sp|Q9LNC0.1|PPR16_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g06270 gi|8844132|gb|AAF80224.1|AC025290_13 Contains similarity to an unknown protein F23N19.4 gi|6630464 from Arabidopsis thaliana gb|AC007190 and contains multiple PPR PF|01535 repeats. EST gb|T44174 comes from this gene [Arabidopsis thaliana] gi|17529194|gb|AAL38823.1| unknown protein [Arabidopsis thaliana] gi|20465473|gb|AAM20196.1| unknown protein [Arabidopsis thaliana] gi|21536601|gb|AAM60933.1| unknown [Arabidopsis thaliana] gi|332189849|gb|AEE27970.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 343 Score = 73.9 bits (180), Expect = 1e-11 Identities = 30/59 (50%), Positives = 51/59 (86%) Frame = +2 Query: 2 EGCLEKKEFVLGGKMVIQMVEKGFIPYIRVRQRVLDGLASVGKRQSACLVRQKLADVRS 178 EGCLE +E++L GK+V++M ++GFIPYI+VRQ+V++ L ++G+ + AC VRQ+++++RS Sbjct: 285 EGCLEVREYILAGKVVMRMTDRGFIPYIKVRQKVVERLINIGEWKLACTVRQRVSELRS 343 >ref|XP_002525148.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535607|gb|EEF37275.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 354 Score = 71.6 bits (174), Expect = 6e-11 Identities = 31/59 (52%), Positives = 45/59 (76%) Frame = +2 Query: 2 EGCLEKKEFVLGGKMVIQMVEKGFIPYIRVRQRVLDGLASVGKRQSACLVRQKLADVRS 178 EGCLE+KE++L K+V++M +KGFIPYI+VRQ+V++GL AC VRQ+ A++ S Sbjct: 296 EGCLERKEYILAAKVVMRMTDKGFIPYIKVRQKVVEGLIDADAWNIACTVRQRFAELSS 354 >ref|XP_002278909.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Vitis vinifera] gi|302143379|emb|CBI21940.3| unnamed protein product [Vitis vinifera] Length = 343 Score = 70.5 bits (171), Expect = 1e-10 Identities = 34/59 (57%), Positives = 46/59 (77%) Frame = +2 Query: 2 EGCLEKKEFVLGGKMVIQMVEKGFIPYIRVRQRVLDGLASVGKRQSACLVRQKLADVRS 178 EGCL EFVL GK+V+ M +GFIPYI VRQ+V++GLA++G+ + A VRQ+ AD+RS Sbjct: 285 EGCLACHEFVLAGKVVMGMTARGFIPYIGVRQKVVEGLANLGEWKLALAVRQRFADLRS 343