BLASTX nr result
ID: Coptis24_contig00031037
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00031037 (207 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270788.1| PREDICTED: pentatricopeptide repeat-containi... 70 2e-10 ref|XP_002524769.1| pentatricopeptide repeat-containing protein,... 57 2e-06 ref|XP_004147968.1| PREDICTED: pentatricopeptide repeat-containi... 55 6e-06 >ref|XP_002270788.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Vitis vinifera] gi|296086664|emb|CBI32299.3| unnamed protein product [Vitis vinifera] Length = 494 Score = 70.1 bits (170), Expect = 2e-10 Identities = 35/65 (53%), Positives = 44/65 (67%) Frame = -3 Query: 205 VAQLCDELVSNQFHSKKVFGILEDKAVPLIRIYSNGSGFVSLLQKLKPWPLLALEVFNWR 26 V+QL DELV + S V +LE+K L R YSNGS FV LL++L WP LAL+VFNWR Sbjct: 66 VSQLRDELVPSGDDSDMVVRVLEEKGESLFRSYSNGSAFVELLKQLSSWPYLALQVFNWR 125 Query: 25 RKKCE 11 R + + Sbjct: 126 RNQTD 130 >ref|XP_002524769.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535953|gb|EEF37612.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 509 Score = 57.0 bits (136), Expect = 2e-06 Identities = 31/65 (47%), Positives = 42/65 (64%) Frame = -3 Query: 205 VAQLCDELVSNQFHSKKVFGILEDKAVPLIRIYSNGSGFVSLLQKLKPWPLLALEVFNWR 26 V+ L DELV + S K F +LE++ L R+ S+ S V LL++L P LA+EVFNWR Sbjct: 81 VSHLRDELVQHAEDSDKFFRVLEEQGDSLFRMRSDRSALVELLRQLVSLPHLAVEVFNWR 140 Query: 25 RKKCE 11 RK+ E Sbjct: 141 RKQTE 145 >ref|XP_004147968.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780-like [Cucumis sativus] gi|449494249|ref|XP_004159492.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780-like [Cucumis sativus] Length = 514 Score = 55.1 bits (131), Expect = 6e-06 Identities = 29/63 (46%), Positives = 41/63 (65%) Frame = -3 Query: 205 VAQLCDELVSNQFHSKKVFGILEDKAVPLIRIYSNGSGFVSLLQKLKPWPLLALEVFNWR 26 V ++ EL+ N S K+ ILED L+ +++GS FV LL++L P LALEVFNWR Sbjct: 85 VLEVSHELILNSEDSNKIVKILEDSKDLLLWKHTDGSAFVELLKQLGSQPNLALEVFNWR 144 Query: 25 RKK 17 R++ Sbjct: 145 RRQ 147