BLASTX nr result
ID: Coptis24_contig00030926
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00030926 (485 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529138.1| serine/threonine protein phosphatase 2a regu... 59 1e-21 ref|XP_003577085.1| PREDICTED: serine/threonine-protein phosphat... 58 2e-21 gb|AAB60713.1| serine/threonine protein phosphatase type 2A regu... 58 3e-21 emb|CAA57527.1| 65 kDa regulatory subunit of protein phosphatase... 58 3e-21 dbj|BAJ33743.1| unnamed protein product [Thellungiella halophila] 58 3e-21 >ref|XP_002529138.1| serine/threonine protein phosphatase 2a regulatory subunit A, putative [Ricinus communis] gi|223531417|gb|EEF33251.1| serine/threonine protein phosphatase 2a regulatory subunit A, putative [Ricinus communis] Length = 587 Score = 58.9 bits (141), Expect(3) = 1e-21 Identities = 31/45 (68%), Positives = 33/45 (73%), Gaps = 8/45 (17%) Frame = -2 Query: 370 RTDLIPAYVW--------VRTEAAGKVTKFCRILNPQLAIHHILP 260 RTDL+PAYV VR AAGKVTKFCRILNP+LAI HILP Sbjct: 278 RTDLVPAYVRLLRDNEAEVRIAAAGKVTKFCRILNPELAIQHILP 322 Score = 48.1 bits (113), Expect(3) = 1e-21 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = -3 Query: 84 VIRIDLLSLSLLPAIIELSEDRHWSVRL 1 VI IDLLS SLLPAI+EL+EDRHW VRL Sbjct: 388 VIGIDLLSQSLLPAIVELAEDRHWRVRL 415 Score = 40.8 bits (94), Expect(3) = 1e-21 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -1 Query: 236 QHVRSALASVIMGMAPVMGK 177 QHVRSALASVIMGMAPV+GK Sbjct: 333 QHVRSALASVIMGMAPVLGK 352 >ref|XP_003577085.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform-like [Brachypodium distachyon] Length = 587 Score = 58.2 bits (139), Expect(3) = 2e-21 Identities = 31/45 (68%), Positives = 33/45 (73%), Gaps = 8/45 (17%) Frame = -2 Query: 370 RTDLIPAYVW--------VRTEAAGKVTKFCRILNPQLAIHHILP 260 RTDL+PAYV VR AAGKVTKFCRIL+PQLAI HILP Sbjct: 278 RTDLVPAYVRLLRDNEAEVRIAAAGKVTKFCRILSPQLAIQHILP 322 Score = 48.1 bits (113), Expect(3) = 2e-21 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = -3 Query: 84 VIRIDLLSLSLLPAIIELSEDRHWSVRL 1 VI IDLLS SLLPAI+EL+EDRHW VRL Sbjct: 388 VIGIDLLSQSLLPAIVELAEDRHWRVRL 415 Score = 40.8 bits (94), Expect(3) = 2e-21 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -1 Query: 236 QHVRSALASVIMGMAPVMGK 177 QHVRSALASVIMGMAPV+GK Sbjct: 333 QHVRSALASVIMGMAPVLGK 352 >gb|AAB60713.1| serine/threonine protein phosphatase type 2A regulatory subunit A [Arabidopsis thaliana] Length = 590 Score = 58.2 bits (139), Expect(3) = 3e-21 Identities = 30/45 (66%), Positives = 33/45 (73%), Gaps = 8/45 (17%) Frame = -2 Query: 370 RTDLIPAYVW--------VRTEAAGKVTKFCRILNPQLAIHHILP 260 RTDL+PAYV VR AAGKVTKFCR+LNP+LAI HILP Sbjct: 278 RTDLVPAYVRLLRDNEAEVRIAAAGKVTKFCRLLNPELAIQHILP 322 Score = 48.1 bits (113), Expect(3) = 3e-21 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = -3 Query: 84 VIRIDLLSLSLLPAIIELSEDRHWSVRL 1 VI IDLLS SLLPAI+EL+EDRHW VRL Sbjct: 388 VIGIDLLSQSLLPAIVELAEDRHWRVRL 415 Score = 40.4 bits (93), Expect(3) = 3e-21 Identities = 18/20 (90%), Positives = 20/20 (100%) Frame = -1 Query: 236 QHVRSALASVIMGMAPVMGK 177 QHVRSALASVIMGMAP++GK Sbjct: 333 QHVRSALASVIMGMAPILGK 352 >emb|CAA57527.1| 65 kDa regulatory subunit of protein phosphatase 2A [Arabidopsis thaliana] Length = 590 Score = 58.2 bits (139), Expect(3) = 3e-21 Identities = 30/45 (66%), Positives = 33/45 (73%), Gaps = 8/45 (17%) Frame = -2 Query: 370 RTDLIPAYVW--------VRTEAAGKVTKFCRILNPQLAIHHILP 260 RTDL+PAYV VR AAGKVTKFCR+LNP+LAI HILP Sbjct: 278 RTDLVPAYVRLLRDNEAEVRIAAAGKVTKFCRLLNPELAIQHILP 322 Score = 48.1 bits (113), Expect(3) = 3e-21 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = -3 Query: 84 VIRIDLLSLSLLPAIIELSEDRHWSVRL 1 VI IDLLS SLLPAI+EL+EDRHW VRL Sbjct: 388 VIGIDLLSQSLLPAIVELAEDRHWRVRL 415 Score = 40.4 bits (93), Expect(3) = 3e-21 Identities = 18/20 (90%), Positives = 20/20 (100%) Frame = -1 Query: 236 QHVRSALASVIMGMAPVMGK 177 QHVRSALASVIMGMAP++GK Sbjct: 333 QHVRSALASVIMGMAPILGK 352 >dbj|BAJ33743.1| unnamed protein product [Thellungiella halophila] Length = 588 Score = 58.2 bits (139), Expect(3) = 3e-21 Identities = 30/45 (66%), Positives = 33/45 (73%), Gaps = 8/45 (17%) Frame = -2 Query: 370 RTDLIPAYVW--------VRTEAAGKVTKFCRILNPQLAIHHILP 260 RTDL+PAYV VR AAGKVTKFCR+LNP+LAI HILP Sbjct: 278 RTDLVPAYVRLLRDNEAEVRIAAAGKVTKFCRLLNPELAIQHILP 322 Score = 48.1 bits (113), Expect(3) = 3e-21 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = -3 Query: 84 VIRIDLLSLSLLPAIIELSEDRHWSVRL 1 VI IDLLS SLLPAI+EL+EDRHW VRL Sbjct: 388 VIGIDLLSQSLLPAIVELAEDRHWRVRL 415 Score = 40.4 bits (93), Expect(3) = 3e-21 Identities = 18/20 (90%), Positives = 20/20 (100%) Frame = -1 Query: 236 QHVRSALASVIMGMAPVMGK 177 QHVRSALASVIMGMAP++GK Sbjct: 333 QHVRSALASVIMGMAPILGK 352