BLASTX nr result
ID: Coptis24_contig00030847
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00030847 (349 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526580.1| Ran GTPase binding protein, putative [Ricinu... 75 6e-12 ref|XP_003538375.1| PREDICTED: uncharacterized protein LOC100794... 73 2e-11 ref|XP_003600638.1| RCC1 and BTB domain-containing protein [Medi... 73 3e-11 emb|CAN82853.1| hypothetical protein VITISV_028768 [Vitis vinifera] 73 3e-11 emb|CAC84086.1| ZR1 protein [Medicago sativa] 73 3e-11 >ref|XP_002526580.1| Ran GTPase binding protein, putative [Ricinus communis] gi|223534074|gb|EEF35792.1| Ran GTPase binding protein, putative [Ricinus communis] Length = 1086 Score = 75.1 bits (183), Expect = 6e-12 Identities = 32/52 (61%), Positives = 42/52 (80%) Frame = +3 Query: 3 LPNGGRGLKRVRFSRKRFSEKEAERWWQENHLRIHEKYEIEGIIGQNKK*DK 158 LP G +GLKRVRFSRKRF+EKEAERWW+EN + +++KY IEG + N+ +K Sbjct: 1034 LPGGEKGLKRVRFSRKRFAEKEAERWWEENQVTVYQKYGIEGYVDSNQHQNK 1085 >ref|XP_003538375.1| PREDICTED: uncharacterized protein LOC100794953 [Glycine max] Length = 1046 Score = 73.2 bits (178), Expect = 2e-11 Identities = 32/47 (68%), Positives = 38/47 (80%) Frame = +3 Query: 3 LPNGGRGLKRVRFSRKRFSEKEAERWWQENHLRIHEKYEIEGIIGQN 143 LP G +GLKRVRFSRKRFSEKEAE+WW+EN + ++ KY IEG I N Sbjct: 992 LPCGKKGLKRVRFSRKRFSEKEAEKWWEENQVTVYHKYGIEGYINNN 1038 >ref|XP_003600638.1| RCC1 and BTB domain-containing protein [Medicago truncatula] gi|355489686|gb|AES70889.1| RCC1 and BTB domain-containing protein [Medicago truncatula] Length = 1032 Score = 72.8 bits (177), Expect = 3e-11 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = +3 Query: 6 PNGGRGLKRVRFSRKRFSEKEAERWWQENHLRIHEKYEIE 125 P+G +GLKRVRFSRKRFS+KEAERWW+EN ++H KYEIE Sbjct: 991 PSGEKGLKRVRFSRKRFSQKEAERWWEENQTKVHHKYEIE 1030 >emb|CAN82853.1| hypothetical protein VITISV_028768 [Vitis vinifera] Length = 1156 Score = 72.8 bits (177), Expect = 3e-11 Identities = 35/54 (64%), Positives = 42/54 (77%), Gaps = 2/54 (3%) Frame = +3 Query: 3 LPNGGRGLKRVRFSRKRFSEKEAERWWQENHLRIHEKYEIEGII--GQNKK*DK 158 L +G RGLKRVRFSRKRF+EKEAERWW+EN + +++ Y IEG I QNK DK Sbjct: 1030 LASGQRGLKRVRFSRKRFTEKEAERWWEENQIGVYQNYGIEGYISSSQNKMKDK 1083 >emb|CAC84086.1| ZR1 protein [Medicago sativa] Length = 1035 Score = 72.8 bits (177), Expect = 3e-11 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = +3 Query: 6 PNGGRGLKRVRFSRKRFSEKEAERWWQENHLRIHEKYEIE 125 P+G +GLKRVRFSRKRFS+KEAERWW+EN ++H KYEIE Sbjct: 994 PSGEKGLKRVRFSRKRFSQKEAERWWEENQTKVHHKYEIE 1033