BLASTX nr result
ID: Coptis24_contig00030748
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00030748 (413 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273988.1| PREDICTED: aspartic proteinase Asp1 [Vitis v... 76 3e-12 ref|XP_002522918.1| nucellin, putative [Ricinus communis] gi|223... 75 7e-12 emb|CAN73001.1| hypothetical protein VITISV_037997 [Vitis vinifera] 71 1e-10 ref|XP_003630348.1| Aspartic proteinase Asp1 [Medicago truncatul... 67 1e-09 ref|XP_003602685.1| Aspartic proteinase Asp1 [Medicago truncatul... 66 3e-09 >ref|XP_002273988.1| PREDICTED: aspartic proteinase Asp1 [Vitis vinifera] gi|296082608|emb|CBI21613.3| unnamed protein product [Vitis vinifera] Length = 426 Score = 75.9 bits (185), Expect = 3e-12 Identities = 40/72 (55%), Positives = 50/72 (69%), Gaps = 5/72 (6%) Frame = +2 Query: 212 ISISGSSAAANQQQHKDKKQTIP-----SLSLHRIGSSAVFPLRGNVYPEGYYYVAVSVG 376 + +SG S+A++ Q HK KK P S ++ I SS VFPL GNVYP GYYYV++S+G Sbjct: 16 VGLSGWSSASDHQ-HKRKKAVFPEPAASSSLINIIQSSVVFPLYGNVYPLGYYYVSLSIG 74 Query: 377 TPPKPYFLDIDT 412 PPKPYFLD DT Sbjct: 75 QPPKPYFLDPDT 86 >ref|XP_002522918.1| nucellin, putative [Ricinus communis] gi|223537845|gb|EEF39461.1| nucellin, putative [Ricinus communis] Length = 433 Score = 74.7 bits (182), Expect = 7e-12 Identities = 36/71 (50%), Positives = 49/71 (69%), Gaps = 6/71 (8%) Frame = +2 Query: 218 ISGSSAAANQQQHKDKKQTI------PSLSLHRIGSSAVFPLRGNVYPEGYYYVAVSVGT 379 ISGSSAA++ + + ++ + S+ ++R GSS VFPL GNVYP GYY V +S+G Sbjct: 20 ISGSSAASSDDRQQRWRKAVLSGEITSSMMINRAGSSLVFPLHGNVYPAGYYNVTLSIGQ 79 Query: 380 PPKPYFLDIDT 412 P KPYFLD+DT Sbjct: 80 PAKPYFLDVDT 90 >emb|CAN73001.1| hypothetical protein VITISV_037997 [Vitis vinifera] Length = 424 Score = 70.9 bits (172), Expect = 1e-10 Identities = 38/72 (52%), Positives = 48/72 (66%), Gaps = 5/72 (6%) Frame = +2 Query: 212 ISISGSSAAANQQQHKDKKQTIP-----SLSLHRIGSSAVFPLRGNVYPEGYYYVAVSVG 376 + +SG S+A++ Q HK KK P S ++ I SS VFPL GNVYP GYYYV++S+G Sbjct: 16 VGLSGWSSASDHQ-HKRKKAVFPEPAASSSLINIIQSSVVFPLYGNVYPLGYYYVSLSIG 74 Query: 377 TPPKPYFLDIDT 412 PP PYFLD T Sbjct: 75 QPPXPYFLDPXT 86 >ref|XP_003630348.1| Aspartic proteinase Asp1 [Medicago truncatula] gi|355524370|gb|AET04824.1| Aspartic proteinase Asp1 [Medicago truncatula] Length = 435 Score = 67.4 bits (163), Expect = 1e-09 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = +2 Query: 278 PSLSLHRIGSSAVFPLRGNVYPEGYYYVAVSVGTPPKPYFLDIDT 412 PSL H GSS VFP+ GNVYP G+Y V +++G PP+PYFLD+DT Sbjct: 49 PSLMNHAAGSSIVFPIYGNVYPVGFYNVTLNIGQPPRPYFLDVDT 93 >ref|XP_003602685.1| Aspartic proteinase Asp1 [Medicago truncatula] gi|355491733|gb|AES72936.1| Aspartic proteinase Asp1 [Medicago truncatula] Length = 440 Score = 66.2 bits (160), Expect = 3e-09 Identities = 31/63 (49%), Positives = 42/63 (66%), Gaps = 1/63 (1%) Frame = +2 Query: 227 SSAAANQQQHKDKKQTIPS-LSLHRIGSSAVFPLRGNVYPEGYYYVAVSVGTPPKPYFLD 403 +S + +Q + PS L+ R GSS VFP+ GNVYP G+Y V +++G PP+PYFLD Sbjct: 42 NSILSYEQPSSSSSSSSPSFLNRFRSGSSVVFPVHGNVYPVGFYNVTINIGYPPRPYFLD 101 Query: 404 IDT 412 IDT Sbjct: 102 IDT 104