BLASTX nr result
ID: Coptis24_contig00030677
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00030677 (466 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003608879.1| hypothetical protein MTR_4g103970 [Medicago ... 62 5e-08 ref|XP_003525668.1| PREDICTED: uncharacterized protein LOC100818... 61 8e-08 ref|XP_003549840.1| PREDICTED: uncharacterized protein LOC100812... 58 7e-07 ref|XP_003634185.1| PREDICTED: uncharacterized protein LOC100246... 58 7e-07 ref|XP_002511236.1| conserved hypothetical protein [Ricinus comm... 55 6e-06 >ref|XP_003608879.1| hypothetical protein MTR_4g103970 [Medicago truncatula] gi|355509934|gb|AES91076.1| hypothetical protein MTR_4g103970 [Medicago truncatula] Length = 67 Score = 62.0 bits (149), Expect = 5e-08 Identities = 30/45 (66%), Positives = 33/45 (73%) Frame = +3 Query: 183 NHHQQKQIQCNMGSVSKFKKSCFNGKEDGATSAILLLACIAFAPS 317 N QQKQIQCN G KFK+S N +EDG +SAIL LACIA APS Sbjct: 21 NQQQQKQIQCNKGKAGKFKRSSSNVEEDGLSSAILFLACIACAPS 65 >ref|XP_003525668.1| PREDICTED: uncharacterized protein LOC100818618 [Glycine max] Length = 69 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +3 Query: 195 QKQIQCNMGSVSKFKKSCFNGKEDGATSAILLLACIAFAPS 317 QKQIQCN G KFK+S N +EDGA+SAIL LACIA+APS Sbjct: 27 QKQIQCNKGKAGKFKRSSSNLEEDGASSAILFLACIAYAPS 67 >ref|XP_003549840.1| PREDICTED: uncharacterized protein LOC100812292 [Glycine max] Length = 69 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = +3 Query: 195 QKQIQCNMGSVSKFKKSCFNGKEDGATSAILLLACIAFAPS 317 QKQIQCN G KFK+S N +EDGA+SAIL LACIA +PS Sbjct: 27 QKQIQCNKGKAGKFKRSSSNLEEDGASSAILFLACIACSPS 67 >ref|XP_003634185.1| PREDICTED: uncharacterized protein LOC100246199 [Vitis vinifera] Length = 70 Score = 58.2 bits (139), Expect = 7e-07 Identities = 31/50 (62%), Positives = 36/50 (72%), Gaps = 6/50 (12%) Frame = +3 Query: 186 HHQQKQIQ------CNMGSVSKFKKSCFNGKEDGATSAILLLACIAFAPS 317 H QQ+Q+Q CN G SKFK+S N +EDGA+SAILLLACIA APS Sbjct: 19 HQQQQQMQKLQIQYCNKGKASKFKRSSSNLEEDGASSAILLLACIACAPS 68 >ref|XP_002511236.1| conserved hypothetical protein [Ricinus communis] gi|255540349|ref|XP_002511239.1| conserved hypothetical protein [Ricinus communis] gi|223550351|gb|EEF51838.1| conserved hypothetical protein [Ricinus communis] gi|223550354|gb|EEF51841.1| conserved hypothetical protein [Ricinus communis] Length = 71 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = +3 Query: 186 HHQQKQIQCNMGSVSKFKKSCFNGKEDGATSAILLLACIA 305 + QKQIQCN G KFK+S N ++DGA+SAILLLACIA Sbjct: 26 YQMQKQIQCNKGKTCKFKRSSSNLEDDGASSAILLLACIA 65