BLASTX nr result
ID: Coptis24_contig00030544
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00030544 (380 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535496.1| conserved hypothetical protein [Ricinus comm... 79 2e-14 >ref|XP_002535496.1| conserved hypothetical protein [Ricinus communis] gi|255596832|ref|XP_002536626.1| conserved hypothetical protein [Ricinus communis] gi|223519048|gb|EEF25756.1| conserved hypothetical protein [Ricinus communis] gi|223522900|gb|EEF26887.1| conserved hypothetical protein [Ricinus communis] Length = 59 Score = 79.3 bits (194), Expect(2) = 2e-14 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +2 Query: 209 LSEVRESMKGHLRLRKNSRKSITERSGDLVLLARREEASGPPFPAR 346 LSE+++SMK HLRLRKNSRKSITERSGDLVLLA REEASGPPF AR Sbjct: 14 LSEMKKSMKRHLRLRKNSRKSITERSGDLVLLAGREEASGPPFSAR 59 Score = 24.6 bits (52), Expect(2) = 2e-14 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = +3 Query: 159 VAEGRRERTHAW 194 +AE RR+RTHAW Sbjct: 1 MAERRRKRTHAW 12