BLASTX nr result
ID: Coptis24_contig00030543
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00030543 (240 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003517673.1| PREDICTED: pentatricopeptide repeat-containi... 91 1e-16 ref|XP_003631475.1| PREDICTED: pentatricopeptide repeat-containi... 89 4e-16 ref|XP_002326536.1| predicted protein [Populus trichocarpa] gi|2... 83 2e-14 ref|XP_002527661.1| pentatricopeptide repeat-containing protein,... 77 2e-12 ref|XP_003612846.1| Pentatricopeptide repeat-containing protein ... 76 2e-12 >ref|XP_003517673.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Glycine max] Length = 827 Score = 90.9 bits (224), Expect = 1e-16 Identities = 41/80 (51%), Positives = 59/80 (73%) Frame = -1 Query: 240 LELSNGVERSLAVFDVLMKVYASSLMLENAVDVFVQVKGIGLQPGLLSCNFMLKCLVQGN 61 L+ VERS VFDVL+ V+AS+ MLENA+DVF K +GL+P + +CNF+LKCLV+ N Sbjct: 237 LDSPQHVERSGVVFDVLISVFASNSMLENALDVFSNAKHVGLEPDIRTCNFLLKCLVEAN 296 Query: 60 KAEYITSVFDVMKNSGPQPD 1 + E++ VF+ +K+ GP P+ Sbjct: 297 RVEFVRRVFEELKDRGPSPN 316 >ref|XP_003631475.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Vitis vinifera] gi|297742067|emb|CBI33854.3| unnamed protein product [Vitis vinifera] Length = 767 Score = 89.0 bits (219), Expect = 4e-16 Identities = 41/80 (51%), Positives = 59/80 (73%) Frame = -1 Query: 240 LELSNGVERSLAVFDVLMKVYASSLMLENAVDVFVQVKGIGLQPGLLSCNFMLKCLVQGN 61 LE RS+ VFD+L+KV+A++ MLENAVDVF+Q K GL+ SCNF+LKCL + N Sbjct: 169 LESPKDAARSVIVFDLLIKVFAANSMLENAVDVFLQAKKTGLELSTRSCNFLLKCLAEAN 228 Query: 60 KAEYITSVFDVMKNSGPQPD 1 + E++ S+F+ MK++GP P+ Sbjct: 229 RREFLRSLFEEMKSTGPPPN 248 >ref|XP_002326536.1| predicted protein [Populus trichocarpa] gi|222833858|gb|EEE72335.1| predicted protein [Populus trichocarpa] Length = 697 Score = 83.2 bits (204), Expect = 2e-14 Identities = 39/74 (52%), Positives = 55/74 (74%) Frame = -1 Query: 222 VERSLAVFDVLMKVYASSLMLENAVDVFVQVKGIGLQPGLLSCNFMLKCLVQGNKAEYIT 43 V RS V +L+KV+AS+ ML +A DVF+Q K IG++ + SCNF+LKCL +G+K E + Sbjct: 111 VGRSATVLSLLIKVFASNKMLADAKDVFMQAKKIGVELNISSCNFLLKCLAEGDKLEAVR 170 Query: 42 SVFDVMKNSGPQPD 1 S+FD +KNSGP P+ Sbjct: 171 SLFDDLKNSGPSPN 184 >ref|XP_002527661.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223532966|gb|EEF34732.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 766 Score = 76.6 bits (187), Expect = 2e-12 Identities = 34/71 (47%), Positives = 52/71 (73%) Frame = -1 Query: 213 SLAVFDVLMKVYASSLMLENAVDVFVQVKGIGLQPGLLSCNFMLKCLVQGNKAEYITSVF 34 S+ V +VL+KV+A + ML +A DVFVQ + GL+ +LSCNF+L C + N+ E+I S+F Sbjct: 177 SIIVANVLIKVFAENNMLVDAADVFVQARRFGLELNILSCNFLLNCFAEANQTEFIRSLF 236 Query: 33 DVMKNSGPQPD 1 + +K+SGP P+ Sbjct: 237 EELKDSGPSPN 247 >ref|XP_003612846.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355514181|gb|AES95804.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 892 Score = 76.3 bits (186), Expect = 2e-12 Identities = 35/74 (47%), Positives = 56/74 (75%) Frame = -1 Query: 222 VERSLAVFDVLMKVYASSLMLENAVDVFVQVKGIGLQPGLLSCNFMLKCLVQGNKAEYIT 43 VE+S VFD+L+KV+AS+ MLE+A VFV+ K G++ ++SCNF+LKCLV+ N+ + + Sbjct: 132 VEKSNVVFDMLIKVFASNSMLEHANYVFVRAKDDGIELNIMSCNFLLKCLVEDNRVDGVR 191 Query: 42 SVFDVMKNSGPQPD 1 +F+V+ GP+P+ Sbjct: 192 LLFEVLIKFGPRPN 205