BLASTX nr result
ID: Coptis24_contig00030523
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00030523 (429 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002325515.1| predicted protein [Populus trichocarpa] gi|2... 64 2e-08 ref|XP_002528032.1| pentatricopeptide repeat-containing protein,... 63 3e-08 ref|XP_004141540.1| PREDICTED: pentatricopeptide repeat-containi... 58 9e-07 emb|CBI31329.3| unnamed protein product [Vitis vinifera] 57 1e-06 ref|XP_002275945.1| PREDICTED: pentatricopeptide repeat-containi... 57 1e-06 >ref|XP_002325515.1| predicted protein [Populus trichocarpa] gi|222862390|gb|EEE99896.1| predicted protein [Populus trichocarpa] Length = 683 Score = 63.5 bits (153), Expect = 2e-08 Identities = 32/58 (55%), Positives = 45/58 (77%), Gaps = 1/58 (1%) Frame = -3 Query: 427 KAVQIITEMPYRPSHAMLATLVSASRIYGNTTIMDWAT-KMLEVRPED*IHHLLIAKL 257 KA ++IT MPYRP+ AM ATLV A RI+GNT I +WA K+LE++PE+ +++LIA + Sbjct: 536 KAKKVITSMPYRPTTAMWATLVGACRIHGNTEIGEWAAEKLLEMKPENPGYYVLIANM 593 >ref|XP_002528032.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223532562|gb|EEF34350.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 730 Score = 62.8 bits (151), Expect = 3e-08 Identities = 32/58 (55%), Positives = 44/58 (75%), Gaps = 1/58 (1%) Frame = -3 Query: 427 KAVQIITEMPYRPSHAMLATLVSASRIYGNTTIMDWAT-KMLEVRPED*IHHLLIAKL 257 KA ++IT MPYRPS AM ATL+ A RI+GN I +WA K+LE+RPE+ +++LIA + Sbjct: 587 KAKEMITRMPYRPSSAMWATLLGACRIHGNAEIGEWAAEKLLEMRPENSGYYVLIANM 644 >ref|XP_004141540.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71490-like [Cucumis sativus] gi|449481506|ref|XP_004156203.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71490-like [Cucumis sativus] Length = 712 Score = 57.8 bits (138), Expect = 9e-07 Identities = 30/58 (51%), Positives = 42/58 (72%), Gaps = 1/58 (1%) Frame = -3 Query: 427 KAVQIITEMPYRPSHAMLATLVSASRIYGNTTIMDWAT-KMLEVRPED*IHHLLIAKL 257 KA +IIT MPYRP+ A+ ATL+ A I+GN I +WA K+LE+RPE +++LIA + Sbjct: 573 KAKEIITRMPYRPTSAIWATLIGACCIHGNMDIGEWAAEKLLEMRPEHSGYYVLIANM 630 >emb|CBI31329.3| unnamed protein product [Vitis vinifera] Length = 753 Score = 57.4 bits (137), Expect = 1e-06 Identities = 29/58 (50%), Positives = 43/58 (74%), Gaps = 1/58 (1%) Frame = -3 Query: 427 KAVQIITEMPYRPSHAMLATLVSASRIYGNTTIMDWAT-KMLEVRPED*IHHLLIAKL 257 KA +II MPY+P+ AM ATL+ A RI+ NT I +WA K+LE++PE+ +++LIA + Sbjct: 549 KAKEIIRNMPYKPTPAMWATLIGACRIHRNTEIGEWAAEKLLEMKPENPGYYVLIANM 606 >ref|XP_002275945.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71490-like [Vitis vinifera] Length = 748 Score = 57.4 bits (137), Expect = 1e-06 Identities = 29/58 (50%), Positives = 43/58 (74%), Gaps = 1/58 (1%) Frame = -3 Query: 427 KAVQIITEMPYRPSHAMLATLVSASRIYGNTTIMDWAT-KMLEVRPED*IHHLLIAKL 257 KA +II MPY+P+ AM ATL+ A RI+ NT I +WA K+LE++PE+ +++LIA + Sbjct: 594 KAKEIIRNMPYKPTPAMWATLIGACRIHRNTEIGEWAAEKLLEMKPENPGYYVLIANM 651