BLASTX nr result
ID: Coptis24_contig00030444
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00030444 (374 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528653.1| cytochrome P450, putative [Ricinus communis]... 99 3e-19 ref|XP_002528654.1| cytochrome P450, putative [Ricinus communis]... 96 2e-18 ref|XP_002528652.1| conserved hypothetical protein [Ricinus comm... 94 9e-18 ref|XP_002528645.1| cytochrome P450, putative [Ricinus communis]... 94 9e-18 ref|XP_002283772.1| PREDICTED: cytochrome P450 76A2 [Vitis vinif... 93 2e-17 >ref|XP_002528653.1| cytochrome P450, putative [Ricinus communis] gi|223531942|gb|EEF33756.1| cytochrome P450, putative [Ricinus communis] Length = 515 Score = 99.4 bits (246), Expect = 3e-19 Identities = 44/69 (63%), Positives = 54/69 (78%) Frame = -2 Query: 373 ELIPFGAGRRRCAGFTMGHTVLHLALGSLLHCFEWELDEPITPENIDMEERLGITLRKNV 194 EL+PFG+GRR C G + H VLHLAL SLLHCF+WEL TPE+IDM ERLGIT+RK V Sbjct: 443 ELLPFGSGRRICVGIPLAHRVLHLALASLLHCFDWELGSNSTPESIDMNERLGITVRKLV 502 Query: 193 PLELVPKTR 167 P++ +PK + Sbjct: 503 PMKAIPKKK 511 >ref|XP_002528654.1| cytochrome P450, putative [Ricinus communis] gi|223531943|gb|EEF33757.1| cytochrome P450, putative [Ricinus communis] Length = 514 Score = 96.3 bits (238), Expect = 2e-18 Identities = 42/69 (60%), Positives = 53/69 (76%) Frame = -2 Query: 373 ELIPFGAGRRRCAGFTMGHTVLHLALGSLLHCFEWELDEPITPENIDMEERLGITLRKNV 194 +L+PFG+GRR C G + H VLHLAL SLLHCF+WEL TPE IDM ERLGI++RK V Sbjct: 443 QLLPFGSGRRICVGIPLAHRVLHLALASLLHCFDWELGSNSTPETIDMNERLGISVRKLV 502 Query: 193 PLELVPKTR 167 P++ +PK + Sbjct: 503 PMKAIPKKK 511 >ref|XP_002528652.1| conserved hypothetical protein [Ricinus communis] gi|223531941|gb|EEF33755.1| conserved hypothetical protein [Ricinus communis] Length = 187 Score = 94.4 bits (233), Expect = 9e-18 Identities = 41/67 (61%), Positives = 52/67 (77%) Frame = -2 Query: 373 ELIPFGAGRRRCAGFTMGHTVLHLALGSLLHCFEWELDEPITPENIDMEERLGITLRKNV 194 EL+PFG+GRR C G + H +LH AL SLLHCF+WEL TPE IDM+ERLGI++RK V Sbjct: 116 ELLPFGSGRRICVGIPLAHRILHPALASLLHCFDWELGSNSTPETIDMKERLGISVRKLV 175 Query: 193 PLELVPK 173 P++ +PK Sbjct: 176 PMKAIPK 182 >ref|XP_002528645.1| cytochrome P450, putative [Ricinus communis] gi|223531934|gb|EEF33748.1| cytochrome P450, putative [Ricinus communis] Length = 502 Score = 94.4 bits (233), Expect = 9e-18 Identities = 41/67 (61%), Positives = 52/67 (77%) Frame = -2 Query: 373 ELIPFGAGRRRCAGFTMGHTVLHLALGSLLHCFEWELDEPITPENIDMEERLGITLRKNV 194 E IPFGAGRR CAG ++ H +LHL LGSLLH F+WEL+ +TP+ +DM +RLG+T+RK Sbjct: 433 EFIPFGAGRRMCAGVSLAHRILHLTLGSLLHHFDWELEANVTPDTLDMRDRLGVTMRKLE 492 Query: 193 PLELVPK 173 PL VPK Sbjct: 493 PLLAVPK 499 >ref|XP_002283772.1| PREDICTED: cytochrome P450 76A2 [Vitis vinifera] Length = 511 Score = 93.2 bits (230), Expect = 2e-17 Identities = 42/71 (59%), Positives = 51/71 (71%) Frame = -2 Query: 373 ELIPFGAGRRRCAGFTMGHTVLHLALGSLLHCFEWELDEPITPENIDMEERLGITLRKNV 194 ELIPFG+GRR C G H V+ L SLLHCF+WEL +TPE IDM ER+G+TLRK V Sbjct: 438 ELIPFGSGRRMCIGMPFAHKVVPFVLASLLHCFDWELGSNLTPETIDMNERVGLTLRKLV 497 Query: 193 PLELVPKTRDV 161 PL+ +P+ R V Sbjct: 498 PLKAIPRKRIV 508