BLASTX nr result
ID: Coptis24_contig00030439
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00030439 (313 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003531533.1| PREDICTED: pentatricopeptide repeat-containi... 74 2e-11 ref|XP_003545705.1| PREDICTED: pentatricopeptide repeat-containi... 73 3e-11 ref|XP_002522615.1| pentatricopeptide repeat-containing protein,... 70 2e-10 ref|NP_568214.1| pentatricopeptide repeat-containing protein [Ar... 68 7e-10 gb|AFK33523.1| unknown [Lotus japonicus] 68 7e-10 >ref|XP_003531533.1| PREDICTED: pentatricopeptide repeat-containing protein At5g09450, mitochondrial-like [Glycine max] Length = 395 Score = 73.6 bits (179), Expect = 2e-11 Identities = 38/86 (44%), Positives = 59/86 (68%) Frame = -3 Query: 260 RINSHPALKLNQTRFLSNTFSSIPLESDDDLEKSKQDDLKTKIFKLRFSKRSVMTLLEKW 81 R NS A LN+TRF+S+ ++ + ++ + DDL+++IF+LR KRS +L+KW Sbjct: 11 RRNSGLACLLNRTRFVSS--GAVSSDLVEESVEGVDDDLRSRIFRLRLPKRSATNVLQKW 68 Query: 80 VADGNNVTLFELRNIARDLNKSQRYK 3 V GN VTL +LR+I+++L +SQRYK Sbjct: 69 VLQGNPVTLSQLRDISKELRRSQRYK 94 >ref|XP_003545705.1| PREDICTED: pentatricopeptide repeat-containing protein At5g09450, mitochondrial-like [Glycine max] Length = 399 Score = 72.8 bits (177), Expect = 3e-11 Identities = 47/104 (45%), Positives = 67/104 (64%), Gaps = 2/104 (1%) Frame = -3 Query: 308 MTMRSLSSLLKRPLIERINSHPALKLNQTRFLSNTFSSIPLESDDDLEKSKQ--DDLKTK 135 M RSL L+R R NS A LN+TRF+S+ S D +E+S + DDL+++ Sbjct: 1 MAHRSLFLSLRRFSSCR-NSGLACVLNRTRFVSSG-----AVSSDLVEESVEGDDDLRSR 54 Query: 134 IFKLRFSKRSVMTLLEKWVADGNNVTLFELRNIARDLNKSQRYK 3 IF+LR KRS +L+KWV GN +TL +LR+I+++L +SQRYK Sbjct: 55 IFRLRLPKRSATNVLQKWVLQGNPITLSQLRDISKELRRSQRYK 98 >ref|XP_002522615.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223538091|gb|EEF39702.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 426 Score = 69.7 bits (169), Expect = 2e-10 Identities = 42/105 (40%), Positives = 58/105 (55%), Gaps = 5/105 (4%) Frame = -3 Query: 302 MRSLSSLLKRPLIERINSHPALKLNQTRFLSNTFSSI-----PLESDDDLEKSKQDDLKT 138 M S S L I RINS N ++ N F S + +++ K +DDLK+ Sbjct: 19 MASRSFLFNLQRICRINSGIGSLSNSKKWEFNHFLSSGTLRNEVLAEESSSKEIEDDLKS 78 Query: 137 KIFKLRFSKRSVMTLLEKWVADGNNVTLFELRNIARDLNKSQRYK 3 +IF+LR KRS ++ WV++GN VT ELRNI+ +L K QRYK Sbjct: 79 RIFRLRLPKRSATNIIHNWVSEGNTVTASELRNISNELRKLQRYK 123 >ref|NP_568214.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75165070|sp|Q94B59.1|PP372_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g09450, mitochondrial; Flags: Precursor gi|14596093|gb|AAK68774.1| putative protein [Arabidopsis thaliana] gi|27311913|gb|AAO00922.1| putative protein [Arabidopsis thaliana] gi|332004012|gb|AED91395.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 409 Score = 68.2 bits (165), Expect = 7e-10 Identities = 28/55 (50%), Positives = 44/55 (80%) Frame = -3 Query: 167 EKSKQDDLKTKIFKLRFSKRSVMTLLEKWVADGNNVTLFELRNIARDLNKSQRYK 3 E ++DDLK++IF+LR KRS T+LEKW+ +GN +T+ ELR I+++L +++RYK Sbjct: 50 ESEEKDDLKSRIFRLRLPKRSATTVLEKWIGEGNQMTINELREISKELRRTRRYK 104 >gb|AFK33523.1| unknown [Lotus japonicus] Length = 358 Score = 68.2 bits (165), Expect = 7e-10 Identities = 35/77 (45%), Positives = 50/77 (64%) Frame = -3 Query: 233 LNQTRFLSNTFSSIPLESDDDLEKSKQDDLKTKIFKLRFSKRSVMTLLEKWVADGNNVTL 54 LN+ RF+S+ S DD DL+++I +LR KRS +L KWV +GN+VT+ Sbjct: 30 LNRARFVSSGAVSTDFVESDD-------DLRSRILRLRLPKRSATNILHKWVLEGNSVTV 82 Query: 53 FELRNIARDLNKSQRYK 3 ELR+IA++L +SQRYK Sbjct: 83 SELRDIAKELRRSQRYK 99