BLASTX nr result
ID: Coptis24_contig00030428
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00030428 (875 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAC95126.1| gag-pol polyprotein [Populus deltoides] 57 1e-08 >emb|CAC95126.1| gag-pol polyprotein [Populus deltoides] Length = 1382 Score = 57.0 bits (136), Expect(2) = 1e-08 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -1 Query: 812 GMDPTNRKSTTGICVFLGDLFISWKTKKQSVVS 714 G DPT+RKS TG C+FLGD ISWK+KKQS+VS Sbjct: 1234 GSDPTDRKSVTGFCIFLGDSLISWKSKKQSIVS 1266 Score = 28.9 bits (63), Expect(2) = 1e-08 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -3 Query: 873 QSVFLPTTSTLTLRAYSDVD 814 QS+ L +TS+L LRAYSD D Sbjct: 1213 QSLLLSSTSSLELRAYSDAD 1232