BLASTX nr result
ID: Coptis24_contig00030421
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00030421 (283 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAS15054.1| DNA-directed DNA polymerase [Daucus carota] 72 4e-11 ref|NP_064103.1| orf135 gene product (mitochondrion) [Beta vulga... 71 8e-11 gb|AFD29780.1| DNA polymerase (mitochondrion) [Silene vulgaris] 69 3e-10 ref|NP_862323.1| hypothetical protein BrnaMpl_p1 [Brassica napus... 67 2e-09 ref|NP_064072.1| orf192 gene product (mitochondrion) [Beta vulga... 65 6e-09 >gb|AAS15054.1| DNA-directed DNA polymerase [Daucus carota] Length = 774 Score = 72.4 bits (176), Expect = 4e-11 Identities = 34/65 (52%), Positives = 45/65 (69%) Frame = +3 Query: 3 RIHMYKYISRSDCYYTNTDSAILGSALPEDEISSNVLGKLKLECEEWVQVLTETGLYCHR 182 RIHMY YI+R DCYYT+TDS +LG+ L +D +SS+VLGKLKLE + + YC+ Sbjct: 494 RIHMYPYIAREDCYYTDTDSIVLGNPLSDDMVSSSVLGKLKLEDQIAWGLFLAPKTYCYT 553 Query: 183 CLHGK 197 + GK Sbjct: 554 TIDGK 558 >ref|NP_064103.1| orf135 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435127|ref|YP_004222345.1| hypothetical protein BevumaM_p111 [Beta vulgaris subsp. maritima] gi|346683218|ref|YP_004842150.1| hypothetical protein BemaM_p106 [Beta macrocarpa] gi|9087353|dbj|BAA99497.1| orf135 [Beta vulgaris subsp. vulgaris] gi|54606688|dbj|BAD66711.1| orf135 [Beta vulgaris subsp. vulgaris] gi|317905681|emb|CBJ14075.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439860|emb|CBJ17565.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148052|emb|CBJ20715.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500136|emb|CBX24955.1| hypothetical protein [Beta macrocarpa] gi|384939117|emb|CBL51963.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 135 Score = 71.2 bits (173), Expect = 8e-11 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = +3 Query: 3 RIHMYKYISRSDCYYTNTDSAILGSALPEDEISSNVLGKLKLE 131 RIHMYKYISR DCYYT+TDS +L + LPED++SS+ LGK KLE Sbjct: 29 RIHMYKYISRDDCYYTDTDSIVLSNPLPEDDVSSSELGKFKLE 71 >gb|AFD29780.1| DNA polymerase (mitochondrion) [Silene vulgaris] Length = 1018 Score = 69.3 bits (168), Expect = 3e-10 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +3 Query: 3 RIHMYKYISRSDCYYTNTDSAILGSALPEDEISSNVLGKLKLE 131 RIHMYKYI+R DCYYT+TDS +LGS L +DE+S LGK+KLE Sbjct: 776 RIHMYKYINRDDCYYTDTDSVVLGSPLSDDEVSPTELGKMKLE 818 >ref|NP_862323.1| hypothetical protein BrnaMpl_p1 [Brassica napus] gi|23200580|dbj|BAC16364.1| orf5 [Brassica napus] Length = 990 Score = 66.6 bits (161), Expect = 2e-09 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = +3 Query: 3 RIHMYKYISRSDCYYTNTDSAILGSALPEDEISSNVLGKLKLE 131 RI+MYKYISRSDCYYT+TDS +L +LP++ ISS+ LGK KLE Sbjct: 770 RIYMYKYISRSDCYYTDTDSVVLQDSLPDEMISSSELGKFKLE 812 >ref|NP_064072.1| orf192 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435092|ref|YP_004222310.1| hypothetical protein BevumaM_p075 [Beta vulgaris subsp. maritima] gi|346683184|ref|YP_004842116.1| hypothetical protein BemaM_p071 [Beta macrocarpa] gi|9087321|dbj|BAA99465.1| orf192 [Beta vulgaris subsp. vulgaris] gi|319439825|emb|CBJ17537.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500102|emb|CBX24920.1| hypothetical protein [Beta macrocarpa] gi|384939153|emb|CBL52000.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 192 Score = 65.1 bits (157), Expect = 6e-09 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = +3 Query: 6 IHMYKYISRSDCYYTNTDSAILGSALPEDEISSNVLGKLKLE 131 I+MY YISR DCYYT+TDS +LG LPE+ +SS+++GK KLE Sbjct: 52 IYMYPYISRDDCYYTDTDSVVLGKPLPEEVVSSSIIGKFKLE 93