BLASTX nr result
ID: Coptis24_contig00030392
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00030392 (312 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002536610.1| conserved hypothetical protein [Ricinus comm... 129 2e-28 ref|XP_002539035.1| conserved hypothetical protein [Ricinus comm... 129 2e-28 ref|YP_002608349.1| orf185 [Vitis vinifera] gi|209954145|emb|CAQ... 129 2e-28 ref|YP_005090367.1| orf186 (mitochondrion) [Phoenix dactylifera]... 128 5e-28 ref|XP_002530828.1| conserved hypothetical protein [Ricinus comm... 120 9e-26 >ref|XP_002536610.1| conserved hypothetical protein [Ricinus communis] gi|223519108|gb|EEF25773.1| conserved hypothetical protein [Ricinus communis] Length = 184 Score = 129 bits (325), Expect = 2e-28 Identities = 64/67 (95%), Positives = 66/67 (98%) Frame = -1 Query: 312 AARGCSCRYVSLSGSLAPPVISFYDMLLSSPYSICHLVISASLRVSTSERNRGLHSVTPR 133 AARGCSCRYVSLSGSLAPPVISFYDMLLSSPYSICHLVISASLRVSTSERN GLHSVTPR Sbjct: 118 AARGCSCRYVSLSGSLAPPVISFYDMLLSSPYSICHLVISASLRVSTSERNGGLHSVTPR 177 Query: 132 SPSKRSK 112 SPS+RS+ Sbjct: 178 SPSERSE 184 >ref|XP_002539035.1| conserved hypothetical protein [Ricinus communis] gi|223509127|gb|EEF23347.1| conserved hypothetical protein [Ricinus communis] Length = 124 Score = 129 bits (325), Expect = 2e-28 Identities = 64/67 (95%), Positives = 66/67 (98%) Frame = -1 Query: 312 AARGCSCRYVSLSGSLAPPVISFYDMLLSSPYSICHLVISASLRVSTSERNRGLHSVTPR 133 AARGCSCRYVSLSGSLAPPVISFYDMLLSSPYSICHLVISASLRVSTSERN GLHSVTPR Sbjct: 58 AARGCSCRYVSLSGSLAPPVISFYDMLLSSPYSICHLVISASLRVSTSERNGGLHSVTPR 117 Query: 132 SPSKRSK 112 SPS+RS+ Sbjct: 118 SPSERSE 124 >ref|YP_002608349.1| orf185 [Vitis vinifera] gi|209954145|emb|CAQ77575.1| orf185 [Vitis vinifera] gi|239764756|gb|ACS15226.1| ORF185 [Vitis vinifera] Length = 184 Score = 129 bits (325), Expect = 2e-28 Identities = 64/67 (95%), Positives = 66/67 (98%) Frame = -1 Query: 312 AARGCSCRYVSLSGSLAPPVISFYDMLLSSPYSICHLVISASLRVSTSERNRGLHSVTPR 133 AARGCSCRYVSLSGSLAPPVISFYDMLLSSPYSICHLVISASLRVSTSERN GLHSVTPR Sbjct: 118 AARGCSCRYVSLSGSLAPPVISFYDMLLSSPYSICHLVISASLRVSTSERNGGLHSVTPR 177 Query: 132 SPSKRSK 112 SPS+RS+ Sbjct: 178 SPSERSE 184 >ref|YP_005090367.1| orf186 (mitochondrion) [Phoenix dactylifera] gi|343478422|gb|AEM43910.1| orf186 (mitochondrion) [Phoenix dactylifera] Length = 185 Score = 128 bits (321), Expect = 5e-28 Identities = 63/67 (94%), Positives = 65/67 (97%) Frame = -1 Query: 312 AARGCSCRYVSLSGSLAPPVISFYDMLLSSPYSICHLVISASLRVSTSERNRGLHSVTPR 133 AARGCSCRYVSLSGSLAPPVISFYDMLLSSPY ICHLVISASLRVSTSERN GLHSVTPR Sbjct: 119 AARGCSCRYVSLSGSLAPPVISFYDMLLSSPYQICHLVISASLRVSTSERNGGLHSVTPR 178 Query: 132 SPSKRSK 112 SPS+RS+ Sbjct: 179 SPSERSE 185 >ref|XP_002530828.1| conserved hypothetical protein [Ricinus communis] gi|223529592|gb|EEF31541.1| conserved hypothetical protein [Ricinus communis] Length = 229 Score = 120 bits (302), Expect = 9e-26 Identities = 60/66 (90%), Positives = 63/66 (95%) Frame = -1 Query: 309 ARGCSCRYVSLSGSLAPPVISFYDMLLSSPYSICHLVISASLRVSTSERNRGLHSVTPRS 130 ARGCSCRYVSLSGSLAPPVISFYDMLLS PYSICHLVISASLRVSTSERN GLHS+T RS Sbjct: 164 ARGCSCRYVSLSGSLAPPVISFYDMLLSLPYSICHLVISASLRVSTSERNGGLHSLTLRS 223 Query: 129 PSKRSK 112 PS+RS+ Sbjct: 224 PSERSE 229