BLASTX nr result
ID: Coptis24_contig00030268
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00030268 (317 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEC84350.1| hypothetical protein OsI_30872 [Oryza sativa Indi... 100 2e-19 ref|NP_173449.1| pentatricopeptide repeat-containing protein [Ar... 97 2e-18 ref|XP_002890375.1| pentatricopeptide repeat-containing protein ... 97 2e-18 gb|EAZ08599.1| hypothetical protein OsI_30870 [Oryza sativa Indi... 97 2e-18 ref|NP_001055349.1| Os05g0370000 [Oryza sativa Japonica Group] g... 97 2e-18 >gb|EEC84350.1| hypothetical protein OsI_30872 [Oryza sativa Indica Group] Length = 122 Score = 99.8 bits (247), Expect = 2e-19 Identities = 42/48 (87%), Positives = 44/48 (91%) Frame = +3 Query: 3 VIKNLRICGDCHTAIKFIARFEGREIYVRDTNRFHHFKDGLCSCGDYW 146 VIKNLRICGDCH A+KFI+ FEGREIYVRDTNRFHHFKDG CSC DYW Sbjct: 75 VIKNLRICGDCHEAMKFISSFEGREIYVRDTNRFHHFKDGKCSCADYW 122 >ref|NP_173449.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|193806503|sp|Q9LNU6.2|PPR53_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g20230 gi|332191832|gb|AEE29953.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 760 Score = 96.7 bits (239), Expect = 2e-18 Identities = 38/48 (79%), Positives = 44/48 (91%) Frame = +3 Query: 3 VIKNLRICGDCHTAIKFIARFEGREIYVRDTNRFHHFKDGLCSCGDYW 146 VIKNLRICGDCH IKFI+ + GREI++RDTNRFHHFKDG+CSCGD+W Sbjct: 713 VIKNLRICGDCHAVIKFISSYAGREIFIRDTNRFHHFKDGICSCGDFW 760 >ref|XP_002890375.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297336217|gb|EFH66634.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 760 Score = 96.7 bits (239), Expect = 2e-18 Identities = 38/48 (79%), Positives = 44/48 (91%) Frame = +3 Query: 3 VIKNLRICGDCHTAIKFIARFEGREIYVRDTNRFHHFKDGLCSCGDYW 146 VIKNLRICGDCH IKFI+ + GREI++RDTNRFHHFKDG+CSCGD+W Sbjct: 713 VIKNLRICGDCHAVIKFISSYAGREIFIRDTNRFHHFKDGICSCGDFW 760 >gb|EAZ08599.1| hypothetical protein OsI_30870 [Oryza sativa Indica Group] Length = 410 Score = 96.7 bits (239), Expect = 2e-18 Identities = 41/48 (85%), Positives = 43/48 (89%) Frame = +3 Query: 3 VIKNLRICGDCHTAIKFIARFEGREIYVRDTNRFHHFKDGLCSCGDYW 146 VIKNLRICGDCH A+KFI+ FE REIYVRDTNRFHHFKDG CSC DYW Sbjct: 363 VIKNLRICGDCHEAMKFISSFERREIYVRDTNRFHHFKDGKCSCADYW 410 >ref|NP_001055349.1| Os05g0370000 [Oryza sativa Japonica Group] gi|54287484|gb|AAV31228.1| unknown protein [Oryza sativa Japonica Group] gi|113578900|dbj|BAF17263.1| Os05g0370000 [Oryza sativa Japonica Group] Length = 664 Score = 96.7 bits (239), Expect = 2e-18 Identities = 41/48 (85%), Positives = 43/48 (89%) Frame = +3 Query: 3 VIKNLRICGDCHTAIKFIARFEGREIYVRDTNRFHHFKDGLCSCGDYW 146 VIKNLRICGDCH A+KFI+ FE REIYVRDTNRFHHFKDG CSC DYW Sbjct: 617 VIKNLRICGDCHEAMKFISSFERREIYVRDTNRFHHFKDGKCSCADYW 664