BLASTX nr result
ID: Coptis24_contig00030047
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00030047 (391 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279376.1| PREDICTED: pentatricopeptide repeat-containi... 137 1e-30 ref|XP_002299231.1| predicted protein [Populus trichocarpa] gi|2... 96 4e-18 ref|XP_002509520.1| pentatricopeptide repeat-containing protein,... 95 7e-18 ref|XP_002274432.1| PREDICTED: pentatricopeptide repeat-containi... 93 2e-17 emb|CAN70142.1| hypothetical protein VITISV_032085 [Vitis vinifera] 93 2e-17 >ref|XP_002279376.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Vitis vinifera] Length = 584 Score = 137 bits (344), Expect = 1e-30 Identities = 66/127 (51%), Positives = 92/127 (72%), Gaps = 5/127 (3%) Frame = +3 Query: 15 LTTLTNP-----NQQKTLSLLRSCKTVHQIKQLHAQLILTDQISNTFLATKLLEFYAITT 179 +TT+T + KTLS L+SCK+ +K++HAQLI+T QI +TF+ATK +E YA++ Sbjct: 14 ITTVTTKFKSKNSNYKTLSALQSCKSTEDLKKIHAQLIITGQIKDTFIATKTVESYAVSA 73 Query: 180 KNIDYALGVFNQISEPNAYTWTSIIRGFVEIKKPKNGIEFYNKMVLHGIEPNKFTFIFLL 359 +NIDYA VF I+ P++Y+WT++IRGFVE K P+ +EFY M G+E NKFTF+F+L Sbjct: 74 RNIDYAFWVFVGINYPDSYSWTTMIRGFVEAKNPEKALEFYGLMRQRGVELNKFTFLFVL 133 Query: 360 KAYSLIP 380 KAY L P Sbjct: 134 KAYGLRP 140 >ref|XP_002299231.1| predicted protein [Populus trichocarpa] gi|222846489|gb|EEE84036.1| predicted protein [Populus trichocarpa] Length = 668 Score = 95.5 bits (236), Expect = 4e-18 Identities = 46/126 (36%), Positives = 78/126 (61%), Gaps = 2/126 (1%) Frame = +3 Query: 18 TTLTNPNQQKTLSLLRSCKTVHQIKQLHAQLILTDQISNTFLATKLLEFYAIT-TKNIDY 194 TT T LSLL +CK+ Q+KQ+ AQ+ILT I + F +++L+ F AI+ ++N+DY Sbjct: 46 TTHTYVLSNPLLSLLENCKSFSQLKQIQAQMILTGLILDGFASSRLISFCAISESRNLDY 105 Query: 195 ALGVFNQISEPNAYTWTSIIRGFVEIKKPKNGIEFYNKMVLH-GIEPNKFTFIFLLKAYS 371 + + N + PN ++W ++IRG VE + P+ G+ Y +M+ G P+ +T+ FL K + Sbjct: 106 CIKILNNLQNPNVFSWNAVIRGCVESENPQKGLVLYKRMLTRAGCRPDNYTYSFLFKVCA 165 Query: 372 LIPIGY 389 + + Y Sbjct: 166 NLVLSY 171 >ref|XP_002509520.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223549419|gb|EEF50907.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 413 Score = 94.7 bits (234), Expect = 7e-18 Identities = 46/117 (39%), Positives = 74/117 (63%), Gaps = 1/117 (0%) Frame = +3 Query: 36 NQQKTLSLLRSCKTVHQIKQLHAQLILTDQISNTFLATKLLEFYAIT-TKNIDYALGVFN 212 N + ++ C ++ Q+KQ+HAQ+ILT +IS+ F A++LL F A++ +++I+YA+ +F Sbjct: 48 NTSIIMDMVDKCTSMTQLKQIHAQMILTSRISDHFAASRLLSFCALSNSRDINYAIKLFK 107 Query: 213 QISEPNAYTWTSIIRGFVEIKKPKNGIEFYNKMVLHGIEPNKFTFIFLLKAYSLIPI 383 I +PN + W +IIR P + FY +M+ G+ PNK+TF FLLK S I Sbjct: 108 SIQDPNIFMWNTIIRALANSSNPDQALFFYIQMLRLGVCPNKYTFPFLLKGCSFCSI 164 >ref|XP_002274432.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Vitis vinifera] Length = 738 Score = 93.2 bits (230), Expect = 2e-17 Identities = 46/107 (42%), Positives = 70/107 (65%), Gaps = 1/107 (0%) Frame = +3 Query: 48 TLSLLRSCKTVHQIKQLHAQLILTDQISNTFLATKLLEFYAITT-KNIDYALGVFNQISE 224 +L+LL +CK+ +KQ+H+Q+I T + F +KL+EF AI+ N+ YAL +F I + Sbjct: 35 SLTLLSTCKSFQNLKQIHSQIIKTGLHNTQFALSKLIEFCAISPFGNLSYALLLFESIEQ 94 Query: 225 PNAYTWTSIIRGFVEIKKPKNGIEFYNKMVLHGIEPNKFTFIFLLKA 365 PN + W ++IRG P I+FY +M+L G+EPN +TF FLLK+ Sbjct: 95 PNQFIWNTMIRGNSLSSSPVGAIDFYVRMLLCGVEPNSYTFPFLLKS 141 >emb|CAN70142.1| hypothetical protein VITISV_032085 [Vitis vinifera] Length = 748 Score = 93.2 bits (230), Expect = 2e-17 Identities = 46/107 (42%), Positives = 70/107 (65%), Gaps = 1/107 (0%) Frame = +3 Query: 48 TLSLLRSCKTVHQIKQLHAQLILTDQISNTFLATKLLEFYAITT-KNIDYALGVFNQISE 224 +L+LL +CK+ +KQ+H+Q+I T + F +KL+EF AI+ N+ YAL +F I + Sbjct: 35 SLTLLSTCKSFQNLKQIHSQIIKTGLHNTQFALSKLIEFCAISPFGNLSYALLLFESIEQ 94 Query: 225 PNAYTWTSIIRGFVEIKKPKNGIEFYNKMVLHGIEPNKFTFIFLLKA 365 PN + W ++IRG P I+FY +M+L G+EPN +TF FLLK+ Sbjct: 95 PNQFIWNTMIRGNSLSSSPVGAIDFYVRMLLCGVEPNSYTFPFLLKS 141