BLASTX nr result
ID: Coptis24_contig00029881
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00029881 (234 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003621771.1| F-box family protein [Medicago truncatula] g... 58 9e-07 ref|XP_002518045.1| ubiquitin-protein ligase, putative [Ricinus ... 58 9e-07 ref|XP_002300155.1| predicted protein [Populus trichocarpa] gi|2... 57 1e-06 >ref|XP_003621771.1| F-box family protein [Medicago truncatula] gi|355496786|gb|AES77989.1| F-box family protein [Medicago truncatula] Length = 524 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/52 (50%), Positives = 37/52 (71%) Frame = +2 Query: 68 TLPQVIIEDNILTRLPVQSLTRFRCVSKTWNMLYTDPRFIDMHLTHSKHNKN 223 TLP ++ + IL+RLPV+SL + +CV K+WN + +DP+FI MHL S N N Sbjct: 93 TLPDEVMAE-ILSRLPVRSLMQIKCVCKSWNTIISDPKFIKMHLNRSARNPN 143 >ref|XP_002518045.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223542641|gb|EEF44178.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 406 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/53 (49%), Positives = 39/53 (73%) Frame = +2 Query: 65 ATLPQVIIEDNILTRLPVQSLTRFRCVSKTWNMLYTDPRFIDMHLTHSKHNKN 223 +TLP+ +I + IL+R+PV+ L RF+CVSK+WN + +DPRF + L +K N N Sbjct: 51 STLPEDLIVE-ILSRVPVKPLLRFKCVSKSWNSIISDPRFAKLQLKRAKENSN 102 >ref|XP_002300155.1| predicted protein [Populus trichocarpa] gi|222847413|gb|EEE84960.1| predicted protein [Populus trichocarpa] Length = 364 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/51 (54%), Positives = 35/51 (68%) Frame = +2 Query: 71 LPQVIIEDNILTRLPVQSLTRFRCVSKTWNMLYTDPRFIDMHLTHSKHNKN 223 LPQ II D ILT LPV+SL RF+CV K W +L +DPRF+ +HL + N Sbjct: 4 LPQDIIVD-ILTYLPVKSLVRFKCVCKPWQLLISDPRFVKLHLKRAIEGNN 53