BLASTX nr result
ID: Coptis24_contig00029735
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00029735 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281711.1| PREDICTED: pentatricopeptide repeat-containi... 77 1e-12 ref|XP_003625322.1| Pentatricopeptide repeat protein [Medicago t... 60 2e-07 ref|XP_002331487.1| predicted protein [Populus trichocarpa] gi|2... 59 3e-07 ref|XP_004148898.1| PREDICTED: pentatricopeptide repeat-containi... 59 4e-07 ref|XP_003553630.1| PREDICTED: pentatricopeptide repeat-containi... 59 5e-07 >ref|XP_002281711.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic [Vitis vinifera] Length = 711 Score = 77.4 bits (189), Expect = 1e-12 Identities = 43/91 (47%), Positives = 53/91 (58%), Gaps = 4/91 (4%) Frame = -3 Query: 263 ATPLFLNNLKP----SFKPPSKXXXXXXXXXXXXXXXTKHPCLVQLEKCSNMSDLKQIHA 96 ATPL L++ +P + P + HPCL+ LEKC+ MS LKQIHA Sbjct: 2 ATPLSLHHPRPPLPTEYPLPLRNAATTANNNNINSQIQLHPCLLSLEKCTTMSQLKQIHA 61 Query: 95 QMLRTGYFSHVFYASQMIAFCALEDSGSLHY 3 QMLRT F F AS+++AFCAL DSGSL Y Sbjct: 62 QMLRTCLFVDPFSASKIVAFCALHDSGSLPY 92 >ref|XP_003625322.1| Pentatricopeptide repeat protein [Medicago truncatula] gi|355500337|gb|AES81540.1| Pentatricopeptide repeat protein [Medicago truncatula] Length = 1024 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/52 (53%), Positives = 35/52 (67%) Frame = -3 Query: 158 HPCLVQLEKCSNMSDLKQIHAQMLRTGYFSHVFYASQMIAFCALEDSGSLHY 3 +P L+ +E CS M LKQI A+M TG +H F S++IAFCAL SG LHY Sbjct: 158 NPTLLIMESCSTMRQLKQIQARMTLTGIITHAFPVSRVIAFCALAHSGDLHY 209 >ref|XP_002331487.1| predicted protein [Populus trichocarpa] gi|222873565|gb|EEF10696.1| predicted protein [Populus trichocarpa] Length = 606 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/52 (48%), Positives = 36/52 (69%) Frame = -3 Query: 158 HPCLVQLEKCSNMSDLKQIHAQMLRTGYFSHVFYASQMIAFCALEDSGSLHY 3 HP L+ +E C++M LKQI A M +T SH F S+++AFCAL DSG +++ Sbjct: 51 HPILLAMESCTSMLQLKQIQAHMTKTALISHTFPVSRVLAFCALSDSGDINH 102 >ref|XP_004148898.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Cucumis sativus] Length = 675 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/52 (50%), Positives = 37/52 (71%) Frame = -3 Query: 158 HPCLVQLEKCSNMSDLKQIHAQMLRTGYFSHVFYASQMIAFCALEDSGSLHY 3 +P L+ L+ CS+M LKQI A + TG + +F AS+++AFCAL DSG +HY Sbjct: 53 NPTLLILQSCSSMFQLKQIQAHITCTGLMNQIFPASRLLAFCALSDSGDIHY 104 >ref|XP_003553630.1| PREDICTED: pentatricopeptide repeat-containing protein At5g06540-like [Glycine max] Length = 622 Score = 58.5 bits (140), Expect = 5e-07 Identities = 31/53 (58%), Positives = 35/53 (66%) Frame = -3 Query: 161 KHPCLVQLEKCSNMSDLKQIHAQMLRTGYFSHVFYASQMIAFCALEDSGSLHY 3 K+P LV LE CSN DLK IHA MLRT F VF AS++IAFC + LHY Sbjct: 17 KNPKLVLLECCSNARDLKIIHAHMLRTHLFFDVFAASRLIAFCIDSTTNLLHY 69