BLASTX nr result
ID: Coptis24_contig00029725
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00029725 (302 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003617643.1| Microtubule-associated protein MAP65-1a [Med... 119 3e-25 emb|CAD58680.1| 65kD microtubule associated protein [Daucus carota] 114 1e-23 ref|XP_003544756.1| PREDICTED: 65-kDa microtubule-associated pro... 114 1e-23 ref|XP_003544755.1| PREDICTED: 65-kDa microtubule-associated pro... 114 1e-23 ref|XP_003519598.1| PREDICTED: 65-kDa microtubule-associated pro... 114 1e-23 >ref|XP_003617643.1| Microtubule-associated protein MAP65-1a [Medicago truncatula] gi|355518978|gb|AET00602.1| Microtubule-associated protein MAP65-1a [Medicago truncatula] Length = 582 Score = 119 bits (297), Expect = 3e-25 Identities = 55/76 (72%), Positives = 67/76 (88%) Frame = -2 Query: 229 MAIADVQNPHVAGNTCGSLLQQLQKIWDEVGECDEERDKMLLQLEQDCLDVYRRSVDHAA 50 MA+ + QNP + NTCGSLL++LQ+IWDEVGE DEERDKMLLQLEQ+CLDVY+R V+HAA Sbjct: 1 MAVTEAQNPLIGENTCGSLLKKLQEIWDEVGESDEERDKMLLQLEQECLDVYKRKVEHAA 60 Query: 49 KSRARLLQALADGRSE 2 KSRA+LLQAL+D + E Sbjct: 61 KSRAQLLQALSDAKLE 76 >emb|CAD58680.1| 65kD microtubule associated protein [Daucus carota] Length = 576 Score = 114 bits (284), Expect = 1e-23 Identities = 56/76 (73%), Positives = 62/76 (81%) Frame = -2 Query: 229 MAIADVQNPHVAGNTCGSLLQQLQKIWDEVGECDEERDKMLLQLEQDCLDVYRRSVDHAA 50 MA D QN + TCGSLLQQLQ+IWDEVGE D ERDKMLLQLEQ+CLDVY+R VDHA Sbjct: 1 MAALDSQNTLLGETTCGSLLQQLQQIWDEVGESDAERDKMLLQLEQECLDVYKRKVDHAV 60 Query: 49 KSRARLLQALADGRSE 2 KSRA LLQ+LADG+ E Sbjct: 61 KSRAHLLQSLADGQVE 76 >ref|XP_003544756.1| PREDICTED: 65-kDa microtubule-associated protein 1-like isoform 2 [Glycine max] Length = 590 Score = 114 bits (284), Expect = 1e-23 Identities = 53/76 (69%), Positives = 66/76 (86%) Frame = -2 Query: 229 MAIADVQNPHVAGNTCGSLLQQLQKIWDEVGECDEERDKMLLQLEQDCLDVYRRSVDHAA 50 MA+ + QNP + NTCGSLL++LQ+IWDEVGE DE+RDKMLLQLEQ+CLDVY+R V+ AA Sbjct: 9 MAVTEAQNPLLGENTCGSLLKKLQEIWDEVGESDEQRDKMLLQLEQECLDVYKRKVEQAA 68 Query: 49 KSRARLLQALADGRSE 2 KSRA+LLQAL+D + E Sbjct: 69 KSRAQLLQALSDAKLE 84 >ref|XP_003544755.1| PREDICTED: 65-kDa microtubule-associated protein 1-like isoform 1 [Glycine max] Length = 582 Score = 114 bits (284), Expect = 1e-23 Identities = 53/76 (69%), Positives = 66/76 (86%) Frame = -2 Query: 229 MAIADVQNPHVAGNTCGSLLQQLQKIWDEVGECDEERDKMLLQLEQDCLDVYRRSVDHAA 50 MA+ + QNP + NTCGSLL++LQ+IWDEVGE DE+RDKMLLQLEQ+CLDVY+R V+ AA Sbjct: 1 MAVTEAQNPLLGENTCGSLLKKLQEIWDEVGESDEQRDKMLLQLEQECLDVYKRKVEQAA 60 Query: 49 KSRARLLQALADGRSE 2 KSRA+LLQAL+D + E Sbjct: 61 KSRAQLLQALSDAKLE 76 >ref|XP_003519598.1| PREDICTED: 65-kDa microtubule-associated protein 1-like [Glycine max] Length = 582 Score = 114 bits (284), Expect = 1e-23 Identities = 53/76 (69%), Positives = 66/76 (86%) Frame = -2 Query: 229 MAIADVQNPHVAGNTCGSLLQQLQKIWDEVGECDEERDKMLLQLEQDCLDVYRRSVDHAA 50 MA+ + QNP + NTCGSLL++LQ+IWDEVGE DE+RDKMLLQLEQ+CLDVY+R V+ AA Sbjct: 1 MAVTEAQNPLLGENTCGSLLKKLQEIWDEVGESDEQRDKMLLQLEQECLDVYKRKVEQAA 60 Query: 49 KSRARLLQALADGRSE 2 KSRA+LLQAL+D + E Sbjct: 61 KSRAQLLQALSDAKLE 76