BLASTX nr result
ID: Coptis24_contig00029689
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00029689 (237 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004158482.1| PREDICTED: pentatricopeptide repeat-containi... 88 8e-16 ref|XP_004152030.1| PREDICTED: pentatricopeptide repeat-containi... 88 8e-16 ref|XP_002279701.2| PREDICTED: pentatricopeptide repeat-containi... 86 3e-15 emb|CBI20513.3| unnamed protein product [Vitis vinifera] 86 3e-15 ref|XP_002522838.1| pentatricopeptide repeat-containing protein,... 85 7e-15 >ref|XP_004158482.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like [Cucumis sativus] Length = 554 Score = 87.8 bits (216), Expect = 8e-16 Identities = 40/75 (53%), Positives = 57/75 (76%) Frame = +3 Query: 12 SFSAVSPILHSIEESCEFDLVHPIYSVIRCHNLKPNDEAFRILIQLFVKMKDFEGAYNML 191 S + ILH+++ESCE++LVH +YS+I HNLKP+ E R +I L VKMKDF+GAY+ML Sbjct: 452 STGVLHSILHALDESCEYNLVHQVYSLICRHNLKPDSEILRGMINLHVKMKDFKGAYDML 511 Query: 192 NDLKEMNMKPTTYMY 236 + ++MN+ PTT +Y Sbjct: 512 KEWEKMNVIPTTNLY 526 >ref|XP_004152030.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like [Cucumis sativus] Length = 1295 Score = 87.8 bits (216), Expect = 8e-16 Identities = 40/75 (53%), Positives = 57/75 (76%) Frame = +3 Query: 12 SFSAVSPILHSIEESCEFDLVHPIYSVIRCHNLKPNDEAFRILIQLFVKMKDFEGAYNML 191 S + ILH+++ESCE++LVH +YS+I HNLKP+ E R +I L VKMKDF+GAY+ML Sbjct: 883 STGVLHSILHALDESCEYNLVHQVYSLICRHNLKPDSEILRGMINLHVKMKDFKGAYDML 942 Query: 192 NDLKEMNMKPTTYMY 236 + ++MN+ PTT +Y Sbjct: 943 KEWEKMNVIPTTNLY 957 >ref|XP_002279701.2| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like [Vitis vinifera] Length = 848 Score = 85.9 bits (211), Expect = 3e-15 Identities = 43/78 (55%), Positives = 56/78 (71%) Frame = +3 Query: 3 LALSFSAVSPILHSIEESCEFDLVHPIYSVIRCHNLKPNDEAFRILIQLFVKMKDFEGAY 182 L LS IL + EES EF+LVH IYSVI +L+PN E FRI+I L VKMKDF+GAY Sbjct: 429 LTLSIEMFHSILRASEESFEFNLVHRIYSVICHQSLEPNCETFRIMINLHVKMKDFDGAY 488 Query: 183 NMLNDLKEMNMKPTTYMY 236 ++L D+K++N+ PT +Y Sbjct: 489 DLLKDMKKINLTPTAGIY 506 >emb|CBI20513.3| unnamed protein product [Vitis vinifera] Length = 618 Score = 85.9 bits (211), Expect = 3e-15 Identities = 43/78 (55%), Positives = 56/78 (71%) Frame = +3 Query: 3 LALSFSAVSPILHSIEESCEFDLVHPIYSVIRCHNLKPNDEAFRILIQLFVKMKDFEGAY 182 L LS IL + EES EF+LVH IYSVI +L+PN E FRI+I L VKMKDF+GAY Sbjct: 199 LTLSIEMFHSILRASEESFEFNLVHRIYSVICHQSLEPNCETFRIMINLHVKMKDFDGAY 258 Query: 183 NMLNDLKEMNMKPTTYMY 236 ++L D+K++N+ PT +Y Sbjct: 259 DLLKDMKKINLTPTAGIY 276 >ref|XP_002522838.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223537922|gb|EEF39536.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 867 Score = 84.7 bits (208), Expect = 7e-15 Identities = 43/78 (55%), Positives = 56/78 (71%) Frame = +3 Query: 3 LALSFSAVSPILHSIEESCEFDLVHPIYSVIRCHNLKPNDEAFRILIQLFVKMKDFEGAY 182 L LS ++ IL + EES EF+LV IYS+I HNL PN+E FR +I+L VKMKDF GA+ Sbjct: 458 LTLSIDVLNSILRACEESFEFNLVQQIYSLICHHNLTPNNETFRSMIKLRVKMKDFCGAH 517 Query: 183 NMLNDLKEMNMKPTTYMY 236 +ML+DLK+ + PT MY Sbjct: 518 DMLDDLKKFKLTPTASMY 535