BLASTX nr result
ID: Coptis24_contig00029651
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00029651 (236 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_006291803.1| orf34 gene product (mitochondrion) [Daucus c... 97 2e-18 ref|XP_002539514.1| conserved hypothetical protein [Ricinus comm... 72 5e-11 >ref|YP_006291803.1| orf34 gene product (mitochondrion) [Daucus carota subsp. sativus] gi|374081980|gb|AEY81172.1| orf34 (mitochondrion) [Daucus carota subsp. sativus] Length = 148 Score = 96.7 bits (239), Expect = 2e-18 Identities = 48/75 (64%), Positives = 54/75 (72%), Gaps = 6/75 (8%) Frame = +1 Query: 19 RGGGVLERTTHVLCCPNPRKGIW*GAT------VRWLTSHFEEATGVLSSNDACGLSHSH 180 RGGG+LERTTH CC P +G G WLT+HFEEATGVLSSNDACGLSHSH Sbjct: 25 RGGGLLERTTH--CCVAPTQGRALGEEHCFEVGKAWLTNHFEEATGVLSSNDACGLSHSH 82 Query: 181 PKWWPNSAWSGRDSN 225 PK WP+SAW GR+ + Sbjct: 83 PKRWPDSAWPGREES 97 >ref|XP_002539514.1| conserved hypothetical protein [Ricinus communis] gi|223505440|gb|EEF22868.1| conserved hypothetical protein [Ricinus communis] Length = 124 Score = 72.0 bits (175), Expect = 5e-11 Identities = 39/59 (66%), Positives = 40/59 (67%), Gaps = 8/59 (13%) Frame = -2 Query: 205 RPNWATTWDGNGSAHMHHLMKALQS--------PPRSGLSTTGP*LLTKCPSLGWGNTA 53 RPN ATTWDGNGSAHMHHLMKALQS PR + LLTKCPS GWGNTA Sbjct: 2 RPNRATTWDGNGSAHMHHLMKALQSSRLLEVACQPR--FPSLKIMLLTKCPSWGWGNTA 58