BLASTX nr result
ID: Coptis24_contig00028931
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00028931 (269 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002454941.1| hypothetical protein SORBIDRAFT_03g001780 [S... 55 6e-06 >ref|XP_002454941.1| hypothetical protein SORBIDRAFT_03g001780 [Sorghum bicolor] gi|241926916|gb|EES00061.1| hypothetical protein SORBIDRAFT_03g001780 [Sorghum bicolor] Length = 631 Score = 55.1 bits (131), Expect = 6e-06 Identities = 21/79 (26%), Positives = 44/79 (55%) Frame = +1 Query: 19 NKATFAKLPWKAMTDKESIWSKTFRAMYGRYWFDVNENPPPHVSWFWKRVHKVAKCISTG 198 N A ++ W+ +T+ +S+ + +A Y + ++ +P P +S+ W+ + K + G Sbjct: 443 NLAMLSRQAWRLLTNPDSLCGQVLKARYFPHSDILHCSPRPRISYTWRSILKGVALLKEG 502 Query: 199 LVWSIGKGKDVRAMHQPWL 255 ++W IG GK+V+ PW+ Sbjct: 503 IIWRIGNGKNVKIWEHPWI 521