BLASTX nr result
ID: Coptis24_contig00028357
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00028357 (354 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285074.2| PREDICTED: putative cyclin-A3-1-like isoform... 57 1e-06 emb|CAA63541.1| cyclin A-like protein [Nicotiana tabacum] 57 2e-06 dbj|BAA20410.1| A-type cyclin [Catharanthus roseus] 56 3e-06 >ref|XP_002285074.2| PREDICTED: putative cyclin-A3-1-like isoform 1 [Vitis vinifera] gi|302142243|emb|CBI19446.3| unnamed protein product [Vitis vinifera] Length = 365 Score = 57.4 bits (137), Expect = 1e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -2 Query: 350 SIRDKYKQHKFKCVATMTSPSEIPKEYFEDIK 255 ++R+KYKQHKFKCVAT++SPS IP YFEDIK Sbjct: 333 AVREKYKQHKFKCVATLSSPSVIPVSYFEDIK 364 >emb|CAA63541.1| cyclin A-like protein [Nicotiana tabacum] Length = 384 Score = 56.6 bits (135), Expect = 2e-06 Identities = 22/34 (64%), Positives = 31/34 (91%) Frame = -2 Query: 353 ASIRDKYKQHKFKCVATMTSPSEIPKEYFEDIKR 252 A++RDKYKQHKFKCV+++TSP EIP +FED+++ Sbjct: 350 AAVRDKYKQHKFKCVSSLTSPVEIPASFFEDMRQ 383 >dbj|BAA20410.1| A-type cyclin [Catharanthus roseus] Length = 372 Score = 55.8 bits (133), Expect = 3e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -2 Query: 350 SIRDKYKQHKFKCVATMTSPSEIPKEYFEDI 258 ++RDKYKQHKFKCV+T+T+P IP E+FEDI Sbjct: 342 AVRDKYKQHKFKCVSTLTAPPSIPDEFFEDI 372