BLASTX nr result
ID: Coptis24_contig00028304
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00028304 (232 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001031651.1| (E)-beta-ocimene synthase [Arabidopsis thali... 56 3e-06 ref|NP_567511.3| (E)-beta-ocimene synthase [Arabidopsis thaliana... 56 3e-06 gb|AAN65379.1| E-beta-ocimene synthase [Arabidopsis thaliana] 56 3e-06 emb|CAB10449.1| limonene cyclase like protein [Arabidopsis thali... 56 3e-06 gb|AAM62867.1| unknown [Arabidopsis thaliana] 56 3e-06 >ref|NP_001031651.1| (E)-beta-ocimene synthase [Arabidopsis thaliana] gi|332658394|gb|AEE83794.1| (E)-beta-ocimene synthase [Arabidopsis thaliana] Length = 396 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/52 (46%), Positives = 38/52 (73%) Frame = +3 Query: 9 LKENVRQLLNNSVGSVHNLELIDAVQRLGVGHHYKEEIKRTLDNIYISTTIA 164 LK+ V ++LN + G + LELID +QRLGV +H+++EIK+TL N+++ A Sbjct: 60 LKQEVSKMLNETEGLLEQLELIDTLQRLGVSYHFEQEIKKTLTNVHVKNVRA 111 >ref|NP_567511.3| (E)-beta-ocimene synthase [Arabidopsis thaliana] gi|205829248|sp|A4FVP2.1|TPS03_ARATH RecName: Full=Tricyclene synthase, chloroplastic; AltName: Full=(E)-beta-ocimene synthase; AltName: Full=(E,E)-alpha-farnesene synthase; AltName: Full=Terpenoid synthase 3; Short=AtTPS03; Flags: Precursor gi|133778826|gb|ABO38753.1| At4g16740 [Arabidopsis thaliana] gi|332658393|gb|AEE83793.1| (E)-beta-ocimene synthase [Arabidopsis thaliana] Length = 565 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/52 (46%), Positives = 38/52 (73%) Frame = +3 Query: 9 LKENVRQLLNNSVGSVHNLELIDAVQRLGVGHHYKEEIKRTLDNIYISTTIA 164 LK+ V ++LN + G + LELID +QRLGV +H+++EIK+TL N+++ A Sbjct: 60 LKQEVSKMLNETEGLLEQLELIDTLQRLGVSYHFEQEIKKTLTNVHVKNVRA 111 >gb|AAN65379.1| E-beta-ocimene synthase [Arabidopsis thaliana] Length = 540 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/52 (46%), Positives = 38/52 (73%) Frame = +3 Query: 9 LKENVRQLLNNSVGSVHNLELIDAVQRLGVGHHYKEEIKRTLDNIYISTTIA 164 LK+ V ++LN + G + LELID +QRLGV +H+++EIK+TL N+++ A Sbjct: 35 LKQEVSKMLNETEGLLEQLELIDTLQRLGVSYHFEQEIKKTLTNVHVKNVRA 86 >emb|CAB10449.1| limonene cyclase like protein [Arabidopsis thaliana] gi|7268424|emb|CAB78716.1| limonene cyclase like protein [Arabidopsis thaliana] Length = 1024 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/52 (46%), Positives = 38/52 (73%) Frame = +3 Query: 9 LKENVRQLLNNSVGSVHNLELIDAVQRLGVGHHYKEEIKRTLDNIYISTTIA 164 LK+ V ++LN + G + LELID +QRLGV +H+++EIK+TL N+++ A Sbjct: 13 LKQEVSKMLNETEGLLEQLELIDTLQRLGVSYHFEQEIKKTLTNVHVKNVRA 64 >gb|AAM62867.1| unknown [Arabidopsis thaliana] Length = 144 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/52 (46%), Positives = 38/52 (73%) Frame = +3 Query: 9 LKENVRQLLNNSVGSVHNLELIDAVQRLGVGHHYKEEIKRTLDNIYISTTIA 164 LK+ V ++LN + G + LELID +QRLGV +H+++EIK+TL N+++ A Sbjct: 60 LKQEVSKMLNETEGLLEQLELIDTLQRLGVSYHFEQEIKKTLTNVHVKNVRA 111