BLASTX nr result
ID: Coptis24_contig00028284
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00028284 (291 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003623049.1| Respiratory burst oxidase-like protein [Medi... 69 4e-10 gb|ABG35770.1| NOX1 [Striga asiatica] 69 5e-10 ref|XP_002322963.1| predicted protein [Populus trichocarpa] gi|2... 68 9e-10 ref|XP_003551464.1| PREDICTED: putative respiratory burst oxidas... 67 2e-09 ref|XP_002308210.1| predicted protein [Populus trichocarpa] gi|2... 66 3e-09 >ref|XP_003623049.1| Respiratory burst oxidase-like protein [Medicago truncatula] gi|358345023|ref|XP_003636584.1| Respiratory burst oxidase-like protein [Medicago truncatula] gi|355498064|gb|AES79267.1| Respiratory burst oxidase-like protein [Medicago truncatula] gi|355502519|gb|AES83722.1| Respiratory burst oxidase-like protein [Medicago truncatula] Length = 870 Score = 68.9 bits (167), Expect = 4e-10 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +3 Query: 111 GVFYCGSPVLTKQLRDLCQEFTLNTTTRFQFHKENF 218 GVFYCGSP LTK L+ LCQEF+LNT+TRF FHKENF Sbjct: 835 GVFYCGSPTLTKSLKSLCQEFSLNTSTRFHFHKENF 870 >gb|ABG35770.1| NOX1 [Striga asiatica] Length = 812 Score = 68.6 bits (166), Expect = 5e-10 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +3 Query: 111 GVFYCGSPVLTKQLRDLCQEFTLNTTTRFQFHKENF 218 GVFYCGSP LTK L+ LCQEF+LN++TRFQFHKENF Sbjct: 777 GVFYCGSPTLTKPLKKLCQEFSLNSSTRFQFHKENF 812 >ref|XP_002322963.1| predicted protein [Populus trichocarpa] gi|222867593|gb|EEF04724.1| predicted protein [Populus trichocarpa] Length = 852 Score = 67.8 bits (164), Expect = 9e-10 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +3 Query: 111 GVFYCGSPVLTKQLRDLCQEFTLNTTTRFQFHKENF 218 GVFYCGS +L K LR+LCQEFTLN++TRFQFHKENF Sbjct: 817 GVFYCGSALLVKPLRELCQEFTLNSSTRFQFHKENF 852 >ref|XP_003551464.1| PREDICTED: putative respiratory burst oxidase homolog protein H-like [Glycine max] Length = 853 Score = 67.0 bits (162), Expect = 2e-09 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = +3 Query: 111 GVFYCGSPVLTKQLRDLCQEFTLNTTTRFQFHKENF 218 GVFYCGSP LTK L++LC EF+LN++TRFQFHKENF Sbjct: 818 GVFYCGSPTLTKTLKELCLEFSLNSSTRFQFHKENF 853 >ref|XP_002308210.1| predicted protein [Populus trichocarpa] gi|222854186|gb|EEE91733.1| predicted protein [Populus trichocarpa] Length = 846 Score = 65.9 bits (159), Expect = 3e-09 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = +3 Query: 111 GVFYCGSPVLTKQLRDLCQEFTLNTTTRFQFHKENF 218 GVFYCGS +L K LR+LCQEFTL+++TRFQFHKENF Sbjct: 811 GVFYCGSALLVKTLRELCQEFTLDSSTRFQFHKENF 846