BLASTX nr result
ID: Coptis24_contig00027997
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00027997 (356 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCD58743.1| unnamed protein product [Schistosoma mansoni] 55 8e-06 >emb|CCD58743.1| unnamed protein product [Schistosoma mansoni] Length = 98 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/46 (54%), Positives = 28/46 (60%) Frame = +1 Query: 19 GPVWSHWLNLVHFQDYPIRLVSCYALLSRCRLPWPLSSCRHGAIPF 156 GPVW + +HFQ + IR VSCY LLS RLPWP S C PF Sbjct: 10 GPVWVQCSSAIHFQGWLIRQVSCYTLLSGFRLPWPPSCCLDQPAPF 55