BLASTX nr result
ID: Coptis24_contig00027880
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00027880 (474 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523009.1| conserved hypothetical protein [Ricinus comm... 55 6e-06 >ref|XP_002523009.1| conserved hypothetical protein [Ricinus communis] gi|223537821|gb|EEF39439.1| conserved hypothetical protein [Ricinus communis] Length = 310 Score = 55.1 bits (131), Expect = 6e-06 Identities = 44/131 (33%), Positives = 59/131 (45%), Gaps = 12/131 (9%) Frame = +1 Query: 112 LKLPTVVCFPQLKCLTLDFVTFYDDCSTENFFSTSCPVLEDLTIDYCRLYNFNTLTISGL 291 L LPT +CFP LK L L+ D+ S E S SCPVLEDL I + + IS Sbjct: 55 LDLPTYICFPSLKILNLEGFLCVDEASMERLVS-SCPVLEDLAIARQEWDDVRIMKISTP 113 Query: 292 RLKALNITNRISHIGICCPNL------------QYVRYHGVKPPNISTQTLSSLLAAKFE 435 LK L+I H + CPN +Y+R+ G + LSSL+ A+ Sbjct: 114 SLKRLSI-----HPNVRCPNYDQETELNTLLWHEYLRHSGTR---WELNVLSSLVEARVY 165 Query: 436 LHQPSNILQTI 468 + +L I Sbjct: 166 VEYDIGLLNGI 176