BLASTX nr result
ID: Coptis24_contig00027855
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00027855 (298 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532264.1| Peptide transporter, putative [Ricinus commu... 55 8e-06 >ref|XP_002532264.1| Peptide transporter, putative [Ricinus communis] gi|223528052|gb|EEF30130.1| Peptide transporter, putative [Ricinus communis] Length = 566 Score = 54.7 bits (130), Expect = 8e-06 Identities = 32/54 (59%), Positives = 37/54 (68%) Frame = -1 Query: 292 KPRGSPFTNLARVVVATIWKKKIPSVSSESKDYYYGNISTETKMAVQGPTSSFR 131 KP GSPFT LARVVVATI K+K+ +SS S+DYYY N + K A T SFR Sbjct: 233 KPEGSPFTALARVVVATIKKRKV-LLSSRSEDYYYEN-DAKAKEAAATVTKSFR 284