BLASTX nr result
ID: Coptis24_contig00027848
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00027848 (296 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003627685.1| Pentatricopeptide repeat-containing protein ... 70 2e-10 ref|XP_002524479.1| pentatricopeptide repeat-containing protein,... 69 4e-10 ref|XP_003521943.1| PREDICTED: pentatricopeptide repeat-containi... 59 4e-07 emb|CBI28186.3| unnamed protein product [Vitis vinifera] 56 3e-06 ref|XP_002281953.1| PREDICTED: pentatricopeptide repeat-containi... 56 3e-06 >ref|XP_003627685.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|358344437|ref|XP_003636296.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|358345563|ref|XP_003636846.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355502231|gb|AES83434.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355502781|gb|AES83984.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355521707|gb|AET02161.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 791 Score = 70.1 bits (170), Expect = 2e-10 Identities = 40/92 (43%), Positives = 58/92 (63%) Frame = +1 Query: 13 RFKNFTKPTKLHLSTLANFKHYDNTHQNDHQLFEKNPQPNHAAIHRSMLSSLHQNQAFEA 192 +F N K T L S K + + +++H LFEK PQPN ++I+RSML+ LH+N F+A Sbjct: 10 KFLNVHKTT-LQRSFKTCLKLFHSLKKHEHNLFEKIPQPNASSINRSMLNFLHKNLPFQA 68 Query: 193 LQILKNQITLGGGPPAVDEVSIAIGLKACRGD 288 L + KNQ T +DEV++A+ KACRG+ Sbjct: 69 LSVFKNQ-TQFPFLQNIDEVTLALSFKACRGE 99 >ref|XP_002524479.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223536267|gb|EEF37919.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 576 Score = 68.9 bits (167), Expect = 4e-10 Identities = 34/69 (49%), Positives = 48/69 (69%) Frame = +1 Query: 82 NTHQNDHQLFEKNPQPNHAAIHRSMLSSLHQNQAFEALQILKNQITLGGGPPAVDEVSIA 261 +T+ N +QL +KN QPN +IHRSML S+H+N F+AL+I K I ++DEV+IA Sbjct: 26 HTYNNAYQLLDKNSQPNSVSIHRSMLDSIHKNLPFQALKIFKKNIQFDFF-NSIDEVTIA 84 Query: 262 IGLKACRGD 288 + LK+C GD Sbjct: 85 LALKSCCGD 93 >ref|XP_003521943.1| PREDICTED: pentatricopeptide repeat-containing protein At4g32430, mitochondrial-like [Glycine max] Length = 895 Score = 58.9 bits (141), Expect = 4e-07 Identities = 33/87 (37%), Positives = 49/87 (56%) Frame = +1 Query: 34 PTKLHLSTLANFKHYDNTHQNDHQLFEKNPQPNHAAIHRSMLSSLHQNQAFEALQILKNQ 213 P +L + F H ++DH F+ P PN A+++ SML+ LH F+AL KN Sbjct: 12 PLQLSFRLCSKFFH---ALKHDHHQFDFIPHPNAASVNHSMLNCLHSRLPFQALTAFKNH 68 Query: 214 ITLGGGPPAVDEVSIAIGLKACRGDTK 294 L VDEV++A+ LKAC+G++K Sbjct: 69 FQL-HSLENVDEVTVALSLKACQGESK 94 >emb|CBI28186.3| unnamed protein product [Vitis vinifera] Length = 760 Score = 56.2 bits (134), Expect = 3e-06 Identities = 29/73 (39%), Positives = 50/73 (68%) Frame = +1 Query: 76 YDNTHQNDHQLFEKNPQPNHAAIHRSMLSSLHQNQAFEALQILKNQITLGGGPPAVDEVS 255 Y ++ ++ HQ +++PQ A+++RSML++L +N + EAL + K Q+ G +D+V+ Sbjct: 24 YFHSSKHVHQPLDQSPQTTIASLNRSMLTALRRNLSLEALDLFKKQLQ-WGFVGNIDQVT 82 Query: 256 IAIGLKACRGDTK 294 +AI LKAC GD+K Sbjct: 83 VAIVLKACCGDSK 95 >ref|XP_002281953.1| PREDICTED: pentatricopeptide repeat-containing protein At4g32430, mitochondrial [Vitis vinifera] Length = 773 Score = 56.2 bits (134), Expect = 3e-06 Identities = 29/73 (39%), Positives = 50/73 (68%) Frame = +1 Query: 76 YDNTHQNDHQLFEKNPQPNHAAIHRSMLSSLHQNQAFEALQILKNQITLGGGPPAVDEVS 255 Y ++ ++ HQ +++PQ A+++RSML++L +N + EAL + K Q+ G +D+V+ Sbjct: 24 YFHSSKHVHQPLDQSPQTTIASLNRSMLTALRRNLSLEALDLFKKQLQ-WGFVGNIDQVT 82 Query: 256 IAIGLKACRGDTK 294 +AI LKAC GD+K Sbjct: 83 VAIVLKACCGDSK 95