BLASTX nr result
ID: Coptis24_contig00027826
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00027826 (305 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_398878.1| hypothetical protein NitoCp045 [Nicotiana tomen... 79 3e-13 ref|YP_004891619.1| unnamed protein product (chloroplast) [Nicot... 79 3e-13 ref|NP_054513.1| hypothetical protein NitaCp037 [Nicotiana tabac... 77 1e-12 ref|NP_001045001.1| Os01g0881600 [Oryza sativa Japonica Group] g... 69 5e-10 ref|XP_003563812.1| PREDICTED: photosystem II reaction center pr... 67 1e-09 >ref|YP_398878.1| hypothetical protein NitoCp045 [Nicotiana tomentosiformis] gi|80750940|dbj|BAE48016.1| hypothetical protein [Nicotiana tomentosiformis] Length = 99 Score = 79.3 bits (194), Expect = 3e-13 Identities = 37/49 (75%), Positives = 44/49 (89%) Frame = +2 Query: 2 LLFNVYNKVHTITTGMNPIQNMNHKRKHLLNRSQEYQLQYL*AKEESFQ 148 L F+V + +H+ITTGMNPI+NMNHKRK+LLNR QEYQLQYL +KEESFQ Sbjct: 51 LRFHVDDSIHSITTGMNPIRNMNHKRKYLLNRLQEYQLQYLLSKEESFQ 99 >ref|YP_004891619.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|347453920|gb|AEO95578.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347454031|gb|AEO95688.1| hypothetical protein [synthetic construct] Length = 99 Score = 79.3 bits (194), Expect = 3e-13 Identities = 37/49 (75%), Positives = 44/49 (89%) Frame = +2 Query: 2 LLFNVYNKVHTITTGMNPIQNMNHKRKHLLNRSQEYQLQYL*AKEESFQ 148 L F+V + +H+ITTGMNPI+NMNHKRK+LLNR QEYQLQYL +KEESFQ Sbjct: 51 LRFHVDDSIHSITTGMNPIRNMNHKRKYLLNRLQEYQLQYLLSKEESFQ 99 >ref|NP_054513.1| hypothetical protein NitaCp037 [Nicotiana tabacum] gi|78102550|ref|YP_358691.1| hypothetical protein NisyCp046 [Nicotiana sylvestris] gi|11846|emb|CAA77366.1| hypothetical protein [Nicotiana tabacum] gi|77799577|dbj|BAE46666.1| hypothetical protein [Nicotiana sylvestris] gi|225214|prf||1211235AV ORF 99A Length = 99 Score = 77.0 bits (188), Expect = 1e-12 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = +2 Query: 2 LLFNVYNKVHTITTGMNPIQNMNHKRKHLLNRSQEYQLQYL*AKEESFQ 148 L F+V + +H+IT GMNPI+NMNHKRK+LLNR QEYQLQYL +KEESFQ Sbjct: 51 LRFHVDDSIHSITRGMNPIRNMNHKRKYLLNRLQEYQLQYLLSKEESFQ 99 >ref|NP_001045001.1| Os01g0881600 [Oryza sativa Japonica Group] gi|113534532|dbj|BAF06915.1| Os01g0881600 [Oryza sativa Japonica Group] Length = 47 Score = 68.6 bits (166), Expect = 5e-10 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -1 Query: 182 MWREVG*MADTTGRIPLWLIGTVAGILVIGLIGVFF 75 MWR+VG MADTTGRIPLWLIGTV GI VIGLIGVFF Sbjct: 1 MWRKVGEMADTTGRIPLWLIGTVTGIAVIGLIGVFF 36 >ref|XP_003563812.1| PREDICTED: photosystem II reaction center protein J-like [Brachypodium distachyon] gi|357149895|ref|XP_003575269.1| PREDICTED: photosystem II reaction center protein J-like [Brachypodium distachyon] gi|357166338|ref|XP_003580677.1| PREDICTED: photosystem II reaction center protein J-like [Brachypodium distachyon] Length = 47 Score = 67.4 bits (163), Expect = 1e-09 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -1 Query: 182 MWREVG*MADTTGRIPLWLIGTVAGILVIGLIGVFF 75 MWR+VG MADTTGRIPLWLIGTV GI VIGL+GVFF Sbjct: 1 MWRKVGEMADTTGRIPLWLIGTVTGIPVIGLVGVFF 36