BLASTX nr result
ID: Coptis24_contig00027598
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00027598 (263 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002460034.1| hypothetical protein SORBIDRAFT_02g021097 [S... 56 3e-06 >ref|XP_002460034.1| hypothetical protein SORBIDRAFT_02g021097 [Sorghum bicolor] gi|241923411|gb|EER96555.1| hypothetical protein SORBIDRAFT_02g021097 [Sorghum bicolor] Length = 292 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/66 (39%), Positives = 42/66 (63%) Frame = -1 Query: 200 GSSKMDEGFQNFTKQRSESSKVPKTELEKYLEEDLFSFDANGKGCDILVWWKNNGPKFPI 21 G +++E F+NF R +S PK++++ Y EE+ + A+ DILVWWK + K+P+ Sbjct: 202 GKRQIEEEFENFRSSRRRAS-APKSKIDTYFEEE---YVADNNSFDILVWWKTHAKKYPV 257 Query: 20 LARMAR 3 L+ MAR Sbjct: 258 LSTMAR 263