BLASTX nr result
ID: Coptis24_contig00027550
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00027550 (215 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514630.1| Cleavage stimulation factor 50 kDa subunit, ... 54 1e-05 >ref|XP_002514630.1| Cleavage stimulation factor 50 kDa subunit, putative [Ricinus communis] gi|223546234|gb|EEF47736.1| Cleavage stimulation factor 50 kDa subunit, putative [Ricinus communis] Length = 435 Score = 54.3 bits (129), Expect = 1e-05 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -2 Query: 91 GTDHHIAHL*DINTLQCYLTANDPEIGVNG 2 GTDH IAHL D+NT QCYL+AN PEIG+NG Sbjct: 244 GTDHQIAHLYDVNTFQCYLSANVPEIGMNG 273