BLASTX nr result
ID: Coptis24_contig00027389
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00027389 (214 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002308068.1| predicted protein [Populus trichocarpa] gi|2... 65 7e-19 ref|XP_003541476.1| PREDICTED: topless-related protein 4-like [G... 65 1e-18 ref|XP_003549747.1| PREDICTED: topless-related protein 4-like [G... 65 1e-18 ref|XP_002527178.1| WD-repeat protein, putative [Ricinus communi... 66 7e-18 ref|XP_002324641.1| predicted protein [Populus trichocarpa] gi|2... 63 5e-17 >ref|XP_002308068.1| predicted protein [Populus trichocarpa] gi|222854044|gb|EEE91591.1| predicted protein [Populus trichocarpa] Length = 1132 Score = 64.7 bits (156), Expect(2) = 7e-19 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +3 Query: 3 SKIWKLSEINEPSQCRSLKLPDNLLPVRVSRLIYTN 110 S+IWKL+EINEPSQCRSL+LPD+L +RVSRLIYTN Sbjct: 748 SRIWKLTEINEPSQCRSLRLPDSLTSMRVSRLIYTN 783 Score = 53.9 bits (128), Expect(2) = 7e-19 Identities = 22/26 (84%), Positives = 26/26 (100%) Frame = +2 Query: 119 SILALASNAVHKLWKWQRNERNPTGR 196 +ILALASNAVHKLWKWQRN+RNP+G+ Sbjct: 787 AILALASNAVHKLWKWQRNDRNPSGK 812 >ref|XP_003541476.1| PREDICTED: topless-related protein 4-like [Glycine max] Length = 1232 Score = 65.5 bits (158), Expect(2) = 1e-18 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +3 Query: 3 SKIWKLSEINEPSQCRSLKLPDNLLPVRVSRLIYTN 110 S+IWKL+EINEPSQCRSLKLPD+L +RVSRLIYTN Sbjct: 850 SRIWKLTEINEPSQCRSLKLPDSLSSMRVSRLIYTN 885 Score = 52.4 bits (124), Expect(2) = 1e-18 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = +2 Query: 119 SILALASNAVHKLWKWQRNERNPTGR 196 +ILALA+NAVHKLWKWQRNERN TG+ Sbjct: 889 AILALAANAVHKLWKWQRNERNTTGK 914 >ref|XP_003549747.1| PREDICTED: topless-related protein 4-like [Glycine max] Length = 1134 Score = 65.5 bits (158), Expect(2) = 1e-18 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +3 Query: 3 SKIWKLSEINEPSQCRSLKLPDNLLPVRVSRLIYTN 110 S+IWKL+EINEPSQCRSLKLPD+L +RVSRLIYTN Sbjct: 752 SRIWKLTEINEPSQCRSLKLPDSLSSMRVSRLIYTN 787 Score = 52.4 bits (124), Expect(2) = 1e-18 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = +2 Query: 119 SILALASNAVHKLWKWQRNERNPTGR 196 +ILALA+NAVHKLWKWQRNERN TG+ Sbjct: 791 AILALAANAVHKLWKWQRNERNTTGK 816 >ref|XP_002527178.1| WD-repeat protein, putative [Ricinus communis] gi|223533443|gb|EEF35191.1| WD-repeat protein, putative [Ricinus communis] Length = 1134 Score = 66.2 bits (160), Expect(2) = 7e-18 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +3 Query: 3 SKIWKLSEINEPSQCRSLKLPDNLLPVRVSRLIYTN 110 S+IWKL+E+NEPSQCRSL+LPDNL +RVSRLIYTN Sbjct: 751 SRIWKLTEVNEPSQCRSLRLPDNLTAMRVSRLIYTN 786 Score = 48.9 bits (115), Expect(2) = 7e-18 Identities = 20/26 (76%), Positives = 24/26 (92%) Frame = +2 Query: 119 SILALASNAVHKLWKWQRNERNPTGR 196 S+L LASNAVHKLWKWQRN+RN +G+ Sbjct: 790 SLLGLASNAVHKLWKWQRNDRNLSGK 815 >ref|XP_002324641.1| predicted protein [Populus trichocarpa] gi|222866075|gb|EEF03206.1| predicted protein [Populus trichocarpa] Length = 1126 Score = 63.2 bits (152), Expect(2) = 5e-17 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = +3 Query: 3 SKIWKLSEINEPSQCRSLKLPDNLLPVRVSRLIYTN 110 S+IWKL+EINEPSQCRSL+LPD+L +RVSRLI+TN Sbjct: 742 SRIWKLTEINEPSQCRSLRLPDSLTAMRVSRLIFTN 777 Score = 49.3 bits (116), Expect(2) = 5e-17 Identities = 21/26 (80%), Positives = 24/26 (92%) Frame = +2 Query: 119 SILALASNAVHKLWKWQRNERNPTGR 196 +ILALASNAVHKLWKWQRN+RN G+ Sbjct: 781 AILALASNAVHKLWKWQRNDRNLPGK 806