BLASTX nr result
ID: Coptis24_contig00027350
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00027350 (310 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533389.1| pheophorbide A oxygenase, putative [Ricinus ... 59 3e-07 ref|XP_002299108.1| predicted protein [Populus trichocarpa] gi|2... 58 9e-07 ref|XP_002304001.1| predicted protein [Populus trichocarpa] gi|2... 55 4e-06 ref|XP_002533392.1| pheophorbide A oxygenase, putative [Ricinus ... 55 6e-06 ref|XP_002304862.1| predicted protein [Populus trichocarpa] gi|2... 55 6e-06 >ref|XP_002533389.1| pheophorbide A oxygenase, putative [Ricinus communis] gi|223526763|gb|EEF28989.1| pheophorbide A oxygenase, putative [Ricinus communis] Length = 509 Score = 59.3 bits (142), Expect = 3e-07 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = -3 Query: 92 ESDGEENKFDWFSHWYPIAAICDLDKKVPH 3 ESD + KFDWFSHWYPI +CDLDK+VPH Sbjct: 76 ESDNQGEKFDWFSHWYPIMPVCDLDKRVPH 105 >ref|XP_002299108.1| predicted protein [Populus trichocarpa] gi|222846366|gb|EEE83913.1| predicted protein [Populus trichocarpa] Length = 476 Score = 57.8 bits (138), Expect = 9e-07 Identities = 19/32 (59%), Positives = 26/32 (81%) Frame = -3 Query: 98 ELESDGEENKFDWFSHWYPIAAICDLDKKVPH 3 ELE+D + KFDW++HWYP+ +CDLDK+ PH Sbjct: 14 ELEADSQAEKFDWYAHWYPVMPVCDLDKRAPH 45 >ref|XP_002304001.1| predicted protein [Populus trichocarpa] gi|222841433|gb|EEE78980.1| predicted protein [Populus trichocarpa] Length = 475 Score = 55.5 bits (132), Expect = 4e-06 Identities = 19/32 (59%), Positives = 26/32 (81%) Frame = -3 Query: 98 ELESDGEENKFDWFSHWYPIAAICDLDKKVPH 3 ELE+ +E KFDW++ WYP+ +CDLDK+VPH Sbjct: 20 ELEAASQEEKFDWYAQWYPVMPVCDLDKRVPH 51 >ref|XP_002533392.1| pheophorbide A oxygenase, putative [Ricinus communis] gi|223526766|gb|EEF28992.1| pheophorbide A oxygenase, putative [Ricinus communis] Length = 552 Score = 55.1 bits (131), Expect = 6e-06 Identities = 20/32 (62%), Positives = 27/32 (84%) Frame = -3 Query: 98 ELESDGEENKFDWFSHWYPIAAICDLDKKVPH 3 ELE+D + +KFDW+S WYP+ +CDLDK+VPH Sbjct: 86 ELETDIQGDKFDWYSAWYPVMPVCDLDKRVPH 117 >ref|XP_002304862.1| predicted protein [Populus trichocarpa] gi|222842294|gb|EEE79841.1| predicted protein [Populus trichocarpa] Length = 256 Score = 55.1 bits (131), Expect = 6e-06 Identities = 20/32 (62%), Positives = 25/32 (78%) Frame = -3 Query: 98 ELESDGEENKFDWFSHWYPIAAICDLDKKVPH 3 ELE D + KFDW++ WYPI +CDLDK+VPH Sbjct: 70 ELEVDSQGEKFDWYAQWYPIMLVCDLDKRVPH 101