BLASTX nr result
ID: Coptis24_contig00027194
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00027194 (637 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272339.1| PREDICTED: pentatricopeptide repeat-containi... 70 3e-10 >ref|XP_002272339.1| PREDICTED: pentatricopeptide repeat-containing protein At2g19280 [Vitis vinifera] Length = 644 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/74 (44%), Positives = 45/74 (60%) Frame = +1 Query: 415 NSRIQKQSLKRVKSILVKRGWNLDLPKGQMIELDDMNVNQILNDIFYETSNAALAFRFFT 594 N + ++ +K IL RGWNL G I+L NV +ILND+F E+++AALA FF Sbjct: 26 NEKAVDDEMEIIKVILTNRGWNLGSQNGYRIDLSQFNVMKILNDLFEESTDAALALYFFR 85 Query: 595 WCEQCNGSKNGIRS 636 W E C GSK+ + S Sbjct: 86 WSEYCMGSKHTVES 99