BLASTX nr result
ID: Coptis24_contig00027159
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00027159 (388 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003635109.1| PREDICTED: pentatricopeptide repeat-containi... 67 1e-09 >ref|XP_003635109.1| PREDICTED: pentatricopeptide repeat-containing protein At5g24830-like [Vitis vinifera] Length = 580 Score = 67.4 bits (163), Expect = 1e-09 Identities = 40/135 (29%), Positives = 67/135 (49%), Gaps = 18/135 (13%) Frame = -3 Query: 356 MVSIVAHQDFHIFLRIIHHTNIRIEAFVNTITQLFTNIHFVLPRNDERS----------- 210 M + Q+ H+F R+ N IE+ + + Q+F N+ P + + Sbjct: 1 MALSIVFQESHVFFRLF---NACIESIKHDVAQIFANVFSFKPYSPANNRPSGHGNLLPF 57 Query: 209 -LND------DSYQINPQDWFLKKETHHNDNEDPHAVFNALDSVLKDTLDRLKKIRESIL 51 L D + YQ+ QDWF + + H ++ DP VFN LD++LKD+L+RLK +RES+ Sbjct: 58 ALEDLIISVGNQYQVTTQDWFSQNKGH-DEERDPRVVFNVLDAILKDSLERLKMMRESVS 116 Query: 50 VAGTSLWECSSKTSF 6 + L C+ + + Sbjct: 117 LTKIGLNGCTLEMDY 131