BLASTX nr result
ID: Coptis24_contig00027135
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00027135 (298 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002307751.1| predicted protein [Populus trichocarpa] gi|2... 55 5e-06 >ref|XP_002307751.1| predicted protein [Populus trichocarpa] gi|222857200|gb|EEE94747.1| predicted protein [Populus trichocarpa] Length = 480 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +2 Query: 5 VLLHLRKAKQIKKHEELVEKMVDRGFVTRPL 97 VL LRKA Q+KKHEELVEKMVDRGFVTRPL Sbjct: 450 VLQQLRKAGQLKKHEELVEKMVDRGFVTRPL 480