BLASTX nr result
ID: Coptis24_contig00027016
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00027016 (497 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519288.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_002519288.1| conserved hypothetical protein [Ricinus communis] gi|223541603|gb|EEF43152.1| conserved hypothetical protein [Ricinus communis] Length = 661 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = -1 Query: 176 KKRFGGTVIVALAVFLVIRFILVENRPKHKQTAYEFFRNYPTNKSN 39 KK GG VI +LAV LV + L+ N+P+ KQ+AY+FFRNYP N S+ Sbjct: 25 KKWSGGVVITSLAVILVFSYSLMGNQPQKKQSAYDFFRNYPANNSD 70