BLASTX nr result
ID: Coptis24_contig00026985
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00026985 (558 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAZ40333.1| hypothetical protein [Raphanus sativus] 60 3e-07 >emb|CAZ40333.1| hypothetical protein [Raphanus sativus] Length = 785 Score = 59.7 bits (143), Expect = 3e-07 Identities = 29/52 (55%), Positives = 36/52 (69%) Frame = -3 Query: 556 KINPNGYRLKLPNTLHTVDVFNVKHLVPYHGDNSDEESVNSRANSFQPGEDD 401 +INPN YR++LP+ L T DVFN+KHL P+ GDN D + S AN QPG D Sbjct: 733 RINPNVYRVRLPSHLRTSDVFNIKHLSPFKGDNDDPD---SWANPSQPGGPD 781