BLASTX nr result
ID: Coptis24_contig00026937
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00026937 (315 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI36296.3| unnamed protein product [Vitis vinifera] 60 5e-15 ref|XP_002517611.1| conserved hypothetical protein [Ricinus comm... 57 3e-14 ref|NP_175672.2| O-fucosyltransferase family protein [Arabidopsi... 59 4e-14 ref|XP_002894391.1| hypothetical protein ARALYDRAFT_474388 [Arab... 59 4e-14 ref|XP_002267150.1| PREDICTED: DUF246 domain-containing protein ... 55 2e-13 >emb|CBI36296.3| unnamed protein product [Vitis vinifera] Length = 443 Score = 60.5 bits (145), Expect(2) = 5e-15 Identities = 27/44 (61%), Positives = 31/44 (70%) Frame = -1 Query: 237 PFPVNYFYIAPPSSSSTQRKSDIWSVPRLVEWRPCKWWIQGHLT 106 P P + F ++P S S RK DIWSV RLVEWRPCKWW+ G LT Sbjct: 29 PSPFSQFSLSPTSPS---RKFDIWSVRRLVEWRPCKWWLDGDLT 69 Score = 45.1 bits (105), Expect(2) = 5e-15 Identities = 19/23 (82%), Positives = 21/23 (91%) Frame = -2 Query: 71 ALPKLSNGFIRVDCYGGLNQMRR 3 ALP +NG+IRVDCYGGLNQMRR Sbjct: 70 ALPAKNNGYIRVDCYGGLNQMRR 92 >ref|XP_002517611.1| conserved hypothetical protein [Ricinus communis] gi|223543243|gb|EEF44775.1| conserved hypothetical protein [Ricinus communis] Length = 441 Score = 57.0 bits (136), Expect(2) = 3e-14 Identities = 26/48 (54%), Positives = 33/48 (68%) Frame = -1 Query: 249 PSTTPFPVNYFYIAPPSSSSTQRKSDIWSVPRLVEWRPCKWWIQGHLT 106 PSTT F ++ P S T + DIWSV R++EWRPCKWW+QGHL+ Sbjct: 28 PSTTSFSSGQ--LSSPDSY-TGKSLDIWSVKRVLEWRPCKWWLQGHLS 72 Score = 45.8 bits (107), Expect(2) = 3e-14 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = -2 Query: 74 AALPKLSNGFIRVDCYGGLNQMRR 3 +ALP SNG++RVDCYGGLNQMRR Sbjct: 72 SALPAESNGYVRVDCYGGLNQMRR 95 >ref|NP_175672.2| O-fucosyltransferase family protein [Arabidopsis thaliana] gi|18491205|gb|AAL69505.1| unknown protein [Arabidopsis thaliana] gi|20465295|gb|AAM20051.1| unknown protein [Arabidopsis thaliana] gi|332194710|gb|AEE32831.1| O-fucosyltransferase family protein [Arabidopsis thaliana] Length = 439 Score = 58.9 bits (141), Expect(2) = 4e-14 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = -1 Query: 207 PPSSSSTQRKSDIWSVPRLVEWRPCKWWIQGHLT 106 P S S+ SDIWSV R++EWRPCKWW+QGHLT Sbjct: 35 PFPSGSSVGSSDIWSVKRIMEWRPCKWWLQGHLT 68 Score = 43.5 bits (101), Expect(2) = 4e-14 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -2 Query: 68 LPKLSNGFIRVDCYGGLNQMRR 3 LP +NG+IRVDCYGGLNQMRR Sbjct: 70 LPAKTNGYIRVDCYGGLNQMRR 91 >ref|XP_002894391.1| hypothetical protein ARALYDRAFT_474388 [Arabidopsis lyrata subsp. lyrata] gi|297340233|gb|EFH70650.1| hypothetical protein ARALYDRAFT_474388 [Arabidopsis lyrata subsp. lyrata] Length = 438 Score = 58.9 bits (141), Expect(2) = 4e-14 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 204 PSSSSTQRKSDIWSVPRLVEWRPCKWWIQGHLT 106 PS SS SDIWSV R+VEWRPCKWW+QGHLT Sbjct: 37 PSGSSVG--SDIWSVKRIVEWRPCKWWLQGHLT 67 Score = 43.5 bits (101), Expect(2) = 4e-14 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -2 Query: 68 LPKLSNGFIRVDCYGGLNQMRR 3 LP +NG+IRVDCYGGLNQMRR Sbjct: 69 LPAKTNGYIRVDCYGGLNQMRR 90 >ref|XP_002267150.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Vitis vinifera] Length = 476 Score = 55.5 bits (132), Expect(2) = 2e-13 Identities = 22/30 (73%), Positives = 24/30 (80%) Frame = -1 Query: 195 SSTQRKSDIWSVPRLVEWRPCKWWIQGHLT 106 +S RK DIWSV RLVEWRPCKWW+ G LT Sbjct: 73 TSRSRKFDIWSVRRLVEWRPCKWWLDGDLT 102 Score = 45.1 bits (105), Expect(2) = 2e-13 Identities = 19/23 (82%), Positives = 21/23 (91%) Frame = -2 Query: 71 ALPKLSNGFIRVDCYGGLNQMRR 3 ALP +NG+IRVDCYGGLNQMRR Sbjct: 103 ALPAKNNGYIRVDCYGGLNQMRR 125