BLASTX nr result
ID: Coptis24_contig00026814
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00026814 (286 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBL52074.1| hypothetical protein (mitochondrion) [Beta vulga... 58 7e-07 dbj|BAG48198.1| hypothetical protein [Beta vulgaris] 58 7e-07 >emb|CBL52074.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 132 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = -3 Query: 209 MNPELLQFLSSMIADIFTIVGFSYIPLIVFILFRAGRLRDLNEE 78 MNP +LQFL+ M I TI G +Y+PLIV I+FRAG LR LNEE Sbjct: 4 MNPYILQFLADMATAILTIAGVAYLPLIVLIVFRAGGLRGLNEE 47 >dbj|BAG48198.1| hypothetical protein [Beta vulgaris] Length = 129 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = -3 Query: 209 MNPELLQFLSSMIADIFTIVGFSYIPLIVFILFRAGRLRDLNEE 78 MNP +LQFL+ M I TI G +Y+PLIV I+FRAG LR LNEE Sbjct: 1 MNPYILQFLADMATAILTIAGVAYLPLIVLIVFRAGGLRGLNEE 44