BLASTX nr result
ID: Coptis24_contig00026767
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00026767 (349 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003589672.1| Pre-rRNA-processing protein IPI3 [Medicago t... 65 6e-14 ref|XP_003531886.1| PREDICTED: WD repeat-containing protein 18-l... 64 1e-13 ref|XP_003551778.1| PREDICTED: WD repeat-containing protein 18-l... 64 1e-13 ref|XP_002284832.1| PREDICTED: WD repeat-containing protein 18 [... 62 5e-13 ref|XP_002327154.1| predicted protein [Populus trichocarpa] gi|2... 64 1e-12 >ref|XP_003589672.1| Pre-rRNA-processing protein IPI3 [Medicago truncatula] gi|355478720|gb|AES59923.1| Pre-rRNA-processing protein IPI3 [Medicago truncatula] Length = 393 Score = 65.5 bits (158), Expect(2) = 6e-14 Identities = 29/51 (56%), Positives = 42/51 (82%) Frame = +2 Query: 71 LFNVIEIQKAK*PYEHSFSEHTLRVTYVVCGTGGCSAIVISASEDQTCKLY 223 LF+ + ++ K YE+SFSEHT+RVT VV G GGC+AI++SAS+D+TCK++ Sbjct: 105 LFDDLRSREEKNLYEYSFSEHTMRVTDVVIGNGGCNAIIVSASDDRTCKVW 155 Score = 36.6 bits (83), Expect(2) = 6e-14 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = +1 Query: 1 SDDKSLLISGSEDGSVCVWSFY 66 SDD SLLISGSEDG V VWS + Sbjct: 82 SDDDSLLISGSEDGYVRVWSLF 103 >ref|XP_003531886.1| PREDICTED: WD repeat-containing protein 18-like [Glycine max] Length = 449 Score = 64.3 bits (155), Expect(2) = 1e-13 Identities = 29/51 (56%), Positives = 40/51 (78%) Frame = +2 Query: 71 LFNVIEIQKAK*PYEHSFSEHTLRVTYVVCGTGGCSAIVISASEDQTCKLY 223 +F+ + Q+A YE+SFSEHTL VT VV G GGC+AI++SAS D+TCK++ Sbjct: 152 IFDDLRCQQASNLYEYSFSEHTLTVTDVVIGNGGCNAIIVSASNDRTCKVW 202 Score = 37.0 bits (84), Expect(2) = 1e-13 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = +1 Query: 1 SDDKSLLISGSEDGSVCVWSFY 66 S+D SLL+SGSEDGSV VWS + Sbjct: 129 SEDDSLLVSGSEDGSVRVWSLF 150 >ref|XP_003551778.1| PREDICTED: WD repeat-containing protein 18-like [Glycine max] Length = 449 Score = 63.9 bits (154), Expect(2) = 1e-13 Identities = 29/51 (56%), Positives = 41/51 (80%) Frame = +2 Query: 71 LFNVIEIQKAK*PYEHSFSEHTLRVTYVVCGTGGCSAIVISASEDQTCKLY 223 +F+ + Q+A YE+SFSEHTL VT VV G GGC+AI++SAS+D+TCK++ Sbjct: 152 IFDDLRNQQASSLYEYSFSEHTLTVTDVVIGNGGCNAIIVSASKDRTCKVW 202 Score = 37.0 bits (84), Expect(2) = 1e-13 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = +1 Query: 1 SDDKSLLISGSEDGSVCVWSFY 66 S+D SLL+SGSEDGSV VWS + Sbjct: 129 SEDDSLLVSGSEDGSVRVWSLF 150 >ref|XP_002284832.1| PREDICTED: WD repeat-containing protein 18 [Vitis vinifera] gi|302142303|emb|CBI19506.3| unnamed protein product [Vitis vinifera] Length = 448 Score = 62.4 bits (150), Expect(2) = 5e-13 Identities = 29/51 (56%), Positives = 41/51 (80%) Frame = +2 Query: 71 LFNVIEIQKAK*PYEHSFSEHTLRVTYVVCGTGGCSAIVISASEDQTCKLY 223 +F+ + ++A YEHSFSEHTLRVT +V G GG +AI++SASED+TCK++ Sbjct: 157 IFDDLRREEAGHLYEHSFSEHTLRVTDIVTGYGGGNAIIVSASEDRTCKVW 207 Score = 36.6 bits (83), Expect(2) = 5e-13 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = +1 Query: 1 SDDKSLLISGSEDGSVCVWSFY 66 SDD+SLLISG+EDG V VWS + Sbjct: 134 SDDESLLISGAEDGCVRVWSLF 155 >ref|XP_002327154.1| predicted protein [Populus trichocarpa] gi|222835469|gb|EEE73904.1| predicted protein [Populus trichocarpa] Length = 446 Score = 64.3 bits (155), Expect(2) = 1e-12 Identities = 30/55 (54%), Positives = 42/55 (76%) Frame = +2 Query: 59 PSTKLFNVIEIQKAK*PYEHSFSEHTLRVTYVVCGTGGCSAIVISASEDQTCKLY 223 P +F+ ++++A YEHSF EHTLRVT +V G GG +AI+ISASED+TCK++ Sbjct: 149 PLLMIFDDYQMEQASQLYEHSFQEHTLRVTDIVTGYGGGNAIIISASEDRTCKVW 203 Score = 33.1 bits (74), Expect(2) = 1e-12 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +1 Query: 1 SDDKSLLISGSEDGSVCVW 57 ++D SLL+SGSEDGSV VW Sbjct: 130 TEDDSLLVSGSEDGSVRVW 148