BLASTX nr result
ID: Coptis24_contig00026410
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00026410 (208 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515912.1| RNA polymerase II mediator complex subunit, ... 56 3e-06 ref|XP_003531638.1| PREDICTED: putative mediator of RNA polymera... 55 6e-06 >ref|XP_002515912.1| RNA polymerase II mediator complex subunit, putative [Ricinus communis] gi|223544817|gb|EEF46332.1| RNA polymerase II mediator complex subunit, putative [Ricinus communis] Length = 251 Score = 56.2 bits (134), Expect = 3e-06 Identities = 29/38 (76%), Positives = 31/38 (81%), Gaps = 2/38 (5%) Frame = +1 Query: 100 PPFPEGYVPP-TSEAEKGSENQQGTETQ-LPLDPIIDQ 207 PPFPEGYVPP T EAEKGSE +Q ETQ P+DPIIDQ Sbjct: 206 PPFPEGYVPPATVEAEKGSETRQAVETQPPPVDPIIDQ 243 >ref|XP_003531638.1| PREDICTED: putative mediator of RNA polymerase II transcription subunit 6-like [Glycine max] Length = 252 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/38 (71%), Positives = 30/38 (78%), Gaps = 2/38 (5%) Frame = +1 Query: 100 PPFPEGYVPP-TSEAEKGSENQQGTETQLP-LDPIIDQ 207 PPFPEGYVPP T+E EKG+E Q+ ETQ P DPIIDQ Sbjct: 207 PPFPEGYVPPPTAETEKGTETQEAAETQAPTADPIIDQ 244