BLASTX nr result
ID: Coptis24_contig00026132
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00026132 (404 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002980512.1| hypothetical protein SELMODRAFT_112999 [Sela... 100 2e-19 ref|XP_002531538.1| conserved hypothetical protein [Ricinus comm... 99 4e-19 ref|XP_002262895.2| PREDICTED: uncharacterized protein L728-like... 96 4e-18 emb|CBI38184.3| unnamed protein product [Vitis vinifera] 96 4e-18 ref|XP_002980659.1| hypothetical protein SELMODRAFT_420109 [Sela... 94 9e-18 >ref|XP_002980512.1| hypothetical protein SELMODRAFT_112999 [Selaginella moellendorffii] gi|300151518|gb|EFJ18163.1| hypothetical protein SELMODRAFT_112999 [Selaginella moellendorffii] Length = 642 Score = 99.8 bits (247), Expect = 2e-19 Identities = 44/69 (63%), Positives = 56/69 (81%) Frame = -1 Query: 404 RQVLELPEIYMSSKNWDSLPYNRVASIAMSNYKKHFLKHNENRFNEFLGKVERGEAKIAA 225 R+ LELPE++MS++ WD LPYNRVAS+AM NY + F+KH+E RF +FL VE G+ KIAA Sbjct: 323 RKALELPEVFMSAQRWDELPYNRVASVAMKNYTEIFMKHDEARFKQFLSDVEAGKKKIAA 382 Query: 224 GALFPHDIM 198 GAL PHDI+ Sbjct: 383 GALLPHDIL 391 >ref|XP_002531538.1| conserved hypothetical protein [Ricinus communis] gi|223528855|gb|EEF30857.1| conserved hypothetical protein [Ricinus communis] Length = 663 Score = 99.0 bits (245), Expect = 4e-19 Identities = 44/68 (64%), Positives = 56/68 (82%) Frame = -1 Query: 401 QVLELPEIYMSSKNWDSLPYNRVASIAMSNYKKHFLKHNENRFNEFLGKVERGEAKIAAG 222 ++LELPE+YMS+K W+SLPYNRV S+AM YK FLKH+E RF E+L V+ G+AKIAAG Sbjct: 340 KILELPEVYMSAKKWNSLPYNRVPSVAMKTYKALFLKHDEERFEEYLDNVKSGKAKIAAG 399 Query: 221 ALFPHDIM 198 AL PH+I+ Sbjct: 400 ALLPHEII 407 >ref|XP_002262895.2| PREDICTED: uncharacterized protein L728-like isoform 1 [Vitis vinifera] Length = 647 Score = 95.5 bits (236), Expect = 4e-18 Identities = 42/69 (60%), Positives = 53/69 (76%) Frame = -1 Query: 404 RQVLELPEIYMSSKNWDSLPYNRVASIAMSNYKKHFLKHNENRFNEFLGKVERGEAKIAA 225 R+ LELPE+YM + W LPYNRVAS+AM YK+ F+KH+E RF E+L V G+AKIAA Sbjct: 348 RRALELPEVYMGANRWSELPYNRVASVAMKTYKERFIKHDEARFFEYLSSVRAGKAKIAA 407 Query: 224 GALFPHDIM 198 GAL PH+I+ Sbjct: 408 GALLPHEII 416 >emb|CBI38184.3| unnamed protein product [Vitis vinifera] Length = 638 Score = 95.5 bits (236), Expect = 4e-18 Identities = 42/69 (60%), Positives = 53/69 (76%) Frame = -1 Query: 404 RQVLELPEIYMSSKNWDSLPYNRVASIAMSNYKKHFLKHNENRFNEFLGKVERGEAKIAA 225 R+ LELPE+YM + W LPYNRVAS+AM YK+ F+KH+E RF E+L V G+AKIAA Sbjct: 339 RRALELPEVYMGANRWSELPYNRVASVAMKTYKERFIKHDEARFFEYLSSVRAGKAKIAA 398 Query: 224 GALFPHDIM 198 GAL PH+I+ Sbjct: 399 GALLPHEII 407 >ref|XP_002980659.1| hypothetical protein SELMODRAFT_420109 [Selaginella moellendorffii] gi|300151665|gb|EFJ18310.1| hypothetical protein SELMODRAFT_420109 [Selaginella moellendorffii] Length = 646 Score = 94.4 bits (233), Expect = 9e-18 Identities = 41/69 (59%), Positives = 54/69 (78%) Frame = -1 Query: 404 RQVLELPEIYMSSKNWDSLPYNRVASIAMSNYKKHFLKHNENRFNEFLGKVERGEAKIAA 225 R+ LELPE+YMS++ WD LPYNRVAS+AM Y K F KH+E RF ++L V+ G+ KIAA Sbjct: 327 RKALELPEVYMSAQRWDELPYNRVASVAMKTYSKIFTKHDEERFKQYLEDVKSGKEKIAA 386 Query: 224 GALFPHDIM 198 GA+ PH+I+ Sbjct: 387 GAVLPHEIL 395