BLASTX nr result
ID: Coptis24_contig00025888
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00025888 (330 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271571.1| PREDICTED: uncharacterized protein LOC100251... 58 7e-07 >ref|XP_002271571.1| PREDICTED: uncharacterized protein LOC100251997 [Vitis vinifera] gi|297740629|emb|CBI30811.3| unnamed protein product [Vitis vinifera] Length = 665 Score = 58.2 bits (139), Expect = 7e-07 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -3 Query: 130 RLVLPPLHSTAMVEEIVETSKEELEFVEVGYICKVHGIEGELR 2 R L PLHSTA EE++ETSK E EFVEVGYI VHG++GE+R Sbjct: 53 RHTLSPLHSTA-TEEVLETSKVESEFVEVGYISSVHGLQGEIR 94