BLASTX nr result
ID: Coptis24_contig00025691
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00025691 (305 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_001152105.1| ORF66a [Pinus koraiensis] gi|145048732|gb|AB... 61 1e-07 >ref|YP_001152105.1| ORF66a [Pinus koraiensis] gi|145048732|gb|ABP35351.1| ORF66a [Pinus koraiensis] Length = 66 Score = 60.8 bits (146), Expect = 1e-07 Identities = 32/49 (65%), Positives = 34/49 (69%), Gaps = 2/49 (4%) Frame = -3 Query: 186 IERDVAQLGSAFVLGTKCHGFKSCHPYLLLLLCAV--MKDQLRSMKIEH 46 I RDVAQLGS FVLGTKC FKSCHPYL LL KD L S++ EH Sbjct: 2 IRRDVAQLGSVFVLGTKCRRFKSCHPYLSLLFYGKKGTKDHLISIRREH 50